![Immunocytochemistry/Immunofluorescence: CIPAR-1 Antibody [NBP1-85610] - Staining of human cell line U-251 MG shows localization to nucleus, cytosol & vesicles. Antibody staining is shown in green.](http://images.novusbio.com/fullsize/CIPAR-1-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-85610-img0005.jpg "Immunocytochemistry/Immunofluorescence: CIPAR-1 Antibody [NBP1-85610] - Staining of human cell line U-251 MG shows localization to nucleus, cytosol & vesicles. Antibody staining is shown in green.")
| Reactivity | HuSpecies Glossary |
| Applications | ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: VPPTTIWTSSPQNTDADTASPSNGTHNNSVLPVTASAPTSLLPKNISIESREEEITSPGSNWEGTNTDPSPSGFSSTSGGVHLTTTLEEHSSGT |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | PARM1 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Immunohistochemistry Neurophysin II/Arg-vasopressin Antibody [Unconjugated]](https://images.novusbio.com/images/antibody/af009_human-neurophysin-ii-affinity-purified-polyclonal-ab-immunohistochemistry-2812202013195.jpg)
| Publication using NBP1-85610 | Applications | Species |
|---|---|---|
| Stadler C, Rexhepaj E, Singan VR et al. Immunofluorescence and fluorescent-protein tagging show high correlation for protein localization in mammalian cells. Nat Methods 2013-04-01 [PMID: 23435261] |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunohistochemistry-Paraffin: CIPAR-1 Antibody [NBP1-85610] - Staining of human colon shows moderate to strong cytoplasmic positivity in glandular cells.](http://images.novusbio.com/fullsize/CIPAR-1-Antibody-Immunohistochemistry-Paraffin-NBP1-85610-img0009.jpg "Immunohistochemistry-Paraffin: CIPAR-1 Antibody [NBP1-85610] - Staining of human colon shows moderate to strong cytoplasmic positivity in glandular cells.")
![Immunohistochemistry-Paraffin: CIPAR-1 Antibody [NBP1-85610] - Staining of human kidney shows weak to moderate positivity in luminal membrane in cells in tubules.](http://images.novusbio.com/fullsize/CIPAR-1-Antibody-Immunohistochemistry-Paraffin-NBP1-85610-img0007.jpg "Immunohistochemistry-Paraffin: CIPAR-1 Antibody [NBP1-85610] - Staining of human kidney shows weak to moderate positivity in luminal membrane in cells in tubules.")
![Immunohistochemistry-Paraffin: CIPAR-1 Antibody [NBP1-85610] - Staining of human placenta shows moderate to strong membranous positivity in trophoblastic cells.](http://images.novusbio.com/fullsize/CIPAR-1-Antibody-Immunohistochemistry-Paraffin-NBP1-85610-img0008.jpg "Immunohistochemistry-Paraffin: CIPAR-1 Antibody [NBP1-85610] - Staining of human placenta shows moderate to strong membranous positivity in trophoblastic cells.")
![SDS-PAGE TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNF-alpha_210-TA_256.jpg)
![Bioactivity TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNFalpha_210TA_1658.jpg)
![SEC-MALS TNF-alpha [Unconjugated]](https://images.novusbio.com/images/210-ta_recombinant-human-tnf-alpha-protein-sec-mals-35202312244..jpg)
![N/A Leptin/OB [HRP]](https://images.novusbio.com/images2/Leptin_DLP00_ELISA_134.jpg)
![N/A Leptin/OB [HRP]](https://images.novusbio.com/images2/DATA_Leptin_DLP00_ELISA_749.jpg)
![Western Blot JNK1 Antibody (228601) [Unconjugated]](https://images.novusbio.com/images2/JNK1_MAB17761_Western_Blot_5991.jpg)
![Western Blot JNK1 Antibody (228601) [Unconjugated]](https://images.novusbio.com/images2/JNK1_MAB17761_Western_Blot_6327.jpg)
![Immunocytochemistry JNK1 Antibody (228601) [Unconjugated]](https://images.novusbio.com/images2/JNK1_MAB17761_Immunocytochemistry__Immunofluorescence_20184.jpg)
![Western Blot PERK Antibody [Unconjugated]](https://images.novusbio.com/images2/PERK_AF3999_Western_Blot_5379.jpg)
![Knockout Validated PERK Antibody [Unconjugated]](https://images.novusbio.com/images2/PERK_AF3999_Knockout_Validated_22482.jpg)
![Western Blot PERK Antibody [Unconjugated]](https://images.novusbio.com/images/af3999_human-perk-affinity-purified-polyclonal-ab-4120241240258.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")