![Immunohistochemistry: Advillin Antibody [NBP2-34118] - Immunohistochemistry of paraffin embedded tissue from distal ileum of C57BL/6 J mice using N-villin (red) and advillin (green) antibodies. Nuclei are counter stained with DAPI. N-villin antibody does not cross-react with advillin in cells that express advillin in apical tufts and along the basolateral surface. Right panel shows higher magnification of boxed area. (d) Immunohistochemistry of cryopreserved tissue from distal ileum of C57BL/6 J mice using N-villin (red) and advillin (green) antibodies. Nuclei are counter stained with DAPI. N-villin does not co-localize with advillin in cells that express advillin in apical tufts and along the basolateral surface. Right panel shows higher magnification of boxed area. Image collected and cropped by CiteAb from the following publication (//www.nature.com/articles/s41598-020-65469-0) licensed under a CC-BY license.](http://images.novusbio.com/fullsize/Advillin-Antibody-Immunohistochemistry-NBP2-34118-img0010.jpg "Immunohistochemistry: Advillin Antibody [NBP2-34118] - Immunohistochemistry of paraffin embedded tissue from distal ileum of C57BL/6 J mice using N-villin (red) and advillin (green) antibodies. Nuclei are counter stained with DAPI. N-villin antibody does not cross-react with advillin in cells that express advillin in apical tufts and along the basolateral surface. Right panel shows higher magnification of boxed area. (d) Immunohistochemistry of cryopreserved tissue from distal ileum of C57BL/6 J mice using N-villin (red) and advillin (green) antibodies. Nuclei are counter stained with DAPI. N-villin does not co-localize with advillin in cells that express advillin in apical tufts and along the basolateral surface. Right panel shows higher magnification of boxed area. Image collected and cropped by CiteAb from the following publication (//www.nature.com/articles/s41598-020-65469-0) licensed under a CC-BY license.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: HASQDELAASAYQAVEVDRQFDGAAVQVRVRMGTEPRHFMAIFKGKLVIFEGGTSRKGNAEPDPPVRLFQIHGNDKSNTKAVEVPA |
| Predicted Species | Mouse (90%), Rat (91%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | AVIL |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for Advillin Antibody (NBP2-34118)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Western Blot: Advillin Antibody [NBP2-34118] - Specificity of villin and advillin antibodies was confirmed by Western analysis using recombinant full-length human villin and human advillin proteins. Two antibodies raised against the amino-terminus of villin (N-villin and N20-villin) did not cross-react with advillin compared to antibodies raised against the carboxyl-terminus of villin (C-villin) or full-length villin (FL-villin) protein. Antibodies raised against the amino-terminus of advillin (N-advillin) and those raised against the carboxyl-terminus of advillin (C-advillin) detect advillin better than they cross-react with villin. Original full length data are available in supplementary Fig S1. Image collected and cropped by CiteAb from the following publication (//www.nature.com/articles/s41598-020-65469-0) licensed under a CC-BY license.](http://images.novusbio.com/fullsize/Advillin-Antibody-Western-Blot-NBP2-34118-img0009.jpg "Western Blot: Advillin Antibody [NBP2-34118] - Specificity of villin and advillin antibodies was confirmed by Western analysis using recombinant full-length human villin and human advillin proteins. Two antibodies raised against the amino-terminus of villin (N-villin and N20-villin) did not cross-react with advillin compared to antibodies raised against the carboxyl-terminus of villin (C-villin) or full-length villin (FL-villin) protein. Antibodies raised against the amino-terminus of advillin (N-advillin) and those raised against the carboxyl-terminus of advillin (C-advillin) detect advillin better than they cross-react with villin. Original full length data are available in supplementary Fig S1. Image collected and cropped by CiteAb from the following publication (//www.nature.com/articles/s41598-020-65469-0) licensed under a CC-BY license.")
![Immunohistochemistry-Paraffin: Advillin Antibody [NBP2-34118] - Staining of human lymphoid tissues shows no positivity as expected.](http://images.novusbio.com/fullsize/Advillin-Antibody-Immunohistochemistry-Paraffin-NBP2-34118-img0006.jpg "Immunohistochemistry-Paraffin: Advillin Antibody [NBP2-34118] - Staining of human lymphoid tissues shows no positivity as expected.")
![Immunohistochemistry-Paraffin: Advillin Antibody [NBP2-34118] - Staining of human stomach shows strong cytoplasmic positivity in neuroendocrine cells.](http://images.novusbio.com/fullsize/Advillin-Antibody-Immunohistochemistry-Paraffin-NBP2-34118-img0008.jpg "Immunohistochemistry-Paraffin: Advillin Antibody [NBP2-34118] - Staining of human stomach shows strong cytoplasmic positivity in neuroendocrine cells.")
![Immunohistochemistry-Paraffin: Advillin Antibody [NBP2-34118] - Staining of human duodenum shows strong cytoplasmic positivity in neuroendocrine cells.](http://images.novusbio.com/fullsize/Advillin-Antibody-Immunohistochemistry-Paraffin-NBP2-34118-img0007.jpg "Immunohistochemistry-Paraffin: Advillin Antibody [NBP2-34118] - Staining of human duodenum shows strong cytoplasmic positivity in neuroendocrine cells.")
![Simple Western Gelsolin/GSN Antibody (893205) [Unconjugated]](https://images.novusbio.com/images2/Gelsolin_MAB8170_Simple_Western_17259.jpg)
![Western Blot Gelsolin/GSN Antibody (893205) [Unconjugated]](https://images.novusbio.com/images2/Gelsolin_MAB8170_Western_Blot_14481.jpg)
![Immunohistochemistry Gelsolin/GSN Antibody (893205) [Unconjugated]](https://images.novusbio.com/images2/Gelsolin_MAB8170_Immunohistochemistry_14553.jpg)
![Knockout Validated STAT3 Antibody (232209) [Unconjugated]](https://images.novusbio.com/images2/STAT3_MAB1799_Simple_Western_21000.jpg)
![Western Blot STAT3 Antibody (232209) [Unconjugated]](https://images.novusbio.com/images2/STAT3_MAB1799_Western_Blot_5993.jpg)
![Knockout Validated STAT3 Antibody (232209) [Unconjugated]](https://images.novusbio.com/images2/STAT3_MAB1799_Knockout_Validated_21531.jpg)
![Western Blot ERK2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ERK2_AF1230_Western_Blot_5097.jpg)
![Immunohistochemistry ERK2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ERK2_AF1230_Immunohistochemistry_20696.jpg)
![Knockout Validated ERK2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ERK2_AF1230_Knockout_Validated_22864.jpg)
![Flow Cytometry SREC-I/SCARF1 Antibody [Unconjugated]](https://images.novusbio.com/images2/SREC-I_AF2409_Flow_Cytometry_8176.jpg)
![Immunohistochemistry p63/TP73L Antibody [Unconjugated]](https://images.novusbio.com/images2/p63_AF1916_Immunohistochemistry_16919.jpg)
![Immunocytochemistry p63/TP73L Antibody [Unconjugated]](https://images.novusbio.com/images2/p63_AF1916_Immunocytochemistry__Immunofluorescence_16973.jpg)
![Immunocytochemistry/ Immunofluorescence p63/TP73L Antibody [Unconjugated]](https://images.novusbio.com/images/af1916_human-p63-tp73l-affinity-purified-polyclonal-ab-41202412401237.jpg)
![Western Blot c-jun [p Ser63] Antibody (1018Y) [Unconjugated]](https://images.novusbio.com/images2/cJun_MAB8930_Western_Blot_18923.jpg)
![Immunocytochemistry c-jun [p Ser63] Antibody (1018Y) [Unconjugated]](https://images.novusbio.com/images2/cJun_MAB8930_Immunocytochemistry__Immunofluorescence_18945.jpg)
![Simple Western c-jun [p Ser63] Antibody (1018Y) [Unconjugated]](https://images.novusbio.com/images2/cJun_MAB8930_Simple_Western_19175.jpg)
![Bioactivity GM-CSF [Unconjugated]](https://images.novusbio.com/images/protein/7954-gmcf_recombinant-human-gm-csf-cho-expressed-protein-cf-bioactivity-272020121514.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")