Home » ADP-Sugar Pyrophosphatase/NUDT5 » NUDT5 Peptides and Proteins » ADP-Sugar Pyrophosphatase/NUDT5 Recombinant Protein Antigen

ADP-Sugar Pyrophosphatase/NUDT5 Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for ADP-Sugar Pyrophosphatase/NUDT5 Protein (NBP1-83131PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals offers 100% Guarantee

ADP-Sugar Pyrophosphatase/NUDT5 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human NUDT5.

Source: E. coli

Amino Acid Sequence: SPAVCMDPGLSNCTIHIVTVTINGDDAENARPKPKPGDGEFVEVISLPKNDLLQRLDALVAEEHLTVDARVYSYALALKHANAKPFEVPFLKF

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
NUDT5
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-83131.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for ADP-Sugar Pyrophosphatase/NUDT5 Recombinant Protein Antigen

  • EC 3.6.1.-
  • EC 3.6.1.13
  • hYSAH1
  • nucleoside diphosphate linked moiety X-type motif 5
  • Nucleoside diphosphate-linked moiety X motif 5
  • nudix (nucleoside diphosphate linked moiety X)-type motif 5
  • Nudix motif 5
  • NUDT5
  • YSA1
  • YSA1H
  • YSA1HADP-sugar pyrophosphatase

Background

Nudix hydrolases, such as NUDT5, eliminate toxic nucleotide derivatives from the cell and regulate the levels of important signaling nucleotides and their metabolites (McLennan, 1999 [PubMed 10373642]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

MTH1 Antibody -
BSA Free
NB100-109
Immunocytochemistry/ Immunofluorescence MTH1 Antibody - BSA Free
Western Blot MTH1 Antibody - BSA Free
Western Blot MTH1 Antibody - BSA Free
(37 Publications)
Species: Hu, Mu, Rt
Applications: IB, ICC/IF, IHC, IHC-Fr, IHC-P, KD, KO, Simple Western, Single-Cell Western, WB
CRAT Antibody
NBP1-86616
Western Blot CRAT Antibody
Western Blot CRAT Antibody
Immunohistochemistry-Paraffin CRAT Antibody
(2 Publications)
Species: Hu
Applications: IHC, IHC-P, WB
GLYAT Antibody
NBP2-58917
Western Blot GLYAT Antibody
Immunohistochemistry-Paraffin GLYAT Antibody
Immunohistochemistry-Paraffin GLYAT Antibody
Species: Hu
Applications: IHC, IHC-P, WB
Catalase Antibody
[Unconjugated]
AF3398
Western Blot Catalase Antibody [Unconjugated]
Simple Western Catalase Antibody [Unconjugated]
Knockout Validated Catalase Antibody [Unconjugated]
(3 Reviews)
(15 Publications)
Species: Hu, Mu, Rt
Applications: ICC, KO, Simple Western, WB
Thioredoxin-1
Antibody - BSA Free
NBP2-52983
Flow Cytometry Thioredoxin-1 Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence Thioredoxin-1 Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence Thioredoxin-1 Antibody - BSA Free
(1 Publication)
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, WB

Enteropeptidase/Entero ...
1585-SE
Enteropeptidase/Enterokinase [Unconjugated]
(8 Publications)
Species: Hu
Applications: EnzAct
NUDT9 Antibody
(OTI7A12)
NBP2-01072
Flow Cytometry NUDT9 Antibody (OTI7A12)
Western Blot NUDT9 Antibody (OTI7A12)
Immunohistochemistry-Paraffin NUDT9 Antibody (OTI7A12)
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Sir2.1 Antibody
NB100-1923
Western Blot Sir2.1 Antibody
(1 Review)
(2 Publications)
Species: Ce
Applications: IHC, IHC-P, IP, WB
TRPM2 Antibody -
BSA Free
NB110-81601
Immunocytochemistry/ Immunofluorescence TRPM2 Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence TRPM2 Antibody - BSA Free
Western Blot TRPM2 Antibody - BSA Free
(17 Publications)
Species: Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
ADPRHL2 Antibody
NBP1-88835
Immunocytochemistry/ Immunofluorescence ADPRHL2 Antibody
Immunohistochemistry-Paraffin ADPRHL2 Antibody
Immunohistochemistry-Paraffin ADPRHL2 Antibody
(1 Review)
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
TNF-alpha
[Unconjugated]
210-TA
SDS-PAGE TNF-alpha [Unconjugated]
Bioactivity TNF-alpha [Unconjugated]
SEC-MALS TNF-alpha [Unconjugated]
(3 Reviews)
(821 Publications)
Species: Hu
Applications: BA
Clusterin/APOJ
Antibody [Unconjugate
AF2747
Immunohistochemistry Clusterin/APOJ Antibody [Unconjugated]
Immunohistochemistry Clusterin/APOJ Antibody [Unconjugated]
Western Blot Clusterin/APOJ Antibody [Unconjugated]
(13 Publications)
Species: Mu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), IHC, IP, WB
CTLA-4
[Unconjugated]
7268-CT
Bioactivity CTLA-4 [Unconjugated]
(3 Publications)
Species: Hu
Applications: BA
MSANTD3 Antibody
NBP2-87845
Western Blot MSANTD3 Antibody
Immunohistochemistry-Paraffin MSANTD3 Antibody
Species: Hu
Applications: IHC, IHC-P, WB
GAPDH Antibody
(1D4)
NB300-221
Western Blot GAPDH Antibody (1D4)
Immunocytochemistry/ Immunofluorescence GAPDH Antibody (1D4)
Immunocytochemistry/ Immunofluorescence GAPDH Antibody (1D4)
(19 Reviews)
(448 Publications)
Species: Av, Bv, Ca, Ch, ChHa, Dr, Eq, Fe, Ha, Hu, Mu, Ma-Op, Po, Pm, Rb, Rt, Sh, Ze
Applications: ChIP, ICC/IF, IHC, IHC-Fr, IP, KD, Simple Western, Single-Cell Western, WB
beta-Actin
Antibody (AC-15)
NB600-501
Western Blot beta-Actin Antibody (AC-15)
Simple Western beta-Actin Antibody (AC-15)
Western Blot beta-Actin Antibody (AC-15)
(27 Reviews)
(615 Publications)
Species: Bv, Ca, Ch, Dr(-), Fe, Fi, Gp, Ha, Hu, Le, Ma, Mu, Po, Pm, Rb, Rt, Sh, Sq, Tr, Ze
Applications: ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD, KO, Simple Western, WB
CD3 Antibody (SP7)
NB600-1441
Immunohistochemistry-Frozen CD3 Antibody (SP7)
Immunohistochemistry-Paraffin CD3 Antibody (SP7)
Immunohistochemistry-Paraffin CD3 Antibody (SP7)
(3 Reviews)
(49 Publications)
Species: Ca, Hu, Mu, Po
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, KD
CD25/IL-2R alpha
[HRP]
DR2A00
N/A CD25/IL-2R alpha [HRP]
N/A CD25/IL-2R alpha [HRP]
(36 Publications)
Species: Hu
Applications: ELISA
IL-2 [Unconjugated]
202-IL
Bioactivity IL-2 [Unconjugated]
(4 Reviews)
(378 Publications)
Species: Hu
Applications: BA
ADP-Sugar
Pyrophosphatase/NUDT5 ...
NBP1-83131PEP
ADP-Sugar Pyrophosphatase/NUDT5 Recombinant Protein Antigen
Species: Hu
Applications: AC

Publications for ADP-Sugar Pyrophosphatase/NUDT5 Protein (NBP1-83131PEP) (0)

There are no publications for ADP-Sugar Pyrophosphatase/NUDT5 Protein (NBP1-83131PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ADP-Sugar Pyrophosphatase/NUDT5 Protein (NBP1-83131PEP) (0)

There are no reviews for ADP-Sugar Pyrophosphatase/NUDT5 Protein (NBP1-83131PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for ADP-Sugar Pyrophosphatase/NUDT5 Protein (NBP1-83131PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional ADP-Sugar Pyrophosphatase/NUDT5 Products

Research Areas for ADP-Sugar Pyrophosphatase/NUDT5 Protein (NBP1-83131PEP)

Find related products by research area.

Blogs on ADP-Sugar Pyrophosphatase/NUDT5

There are no specific blogs for ADP-Sugar Pyrophosphatase/NUDT5, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
TNF-alpha [Unconjugated]
210-TA-005
Western Blot: beta-Actin Antibody (AC-15) [NB600-501] - HEK293T cells transfected with Niaph virus Matrix Protein, expression 24h later. This image was submitted via customer review.
beta-Actin Antibody (AC-15)
NB600-501
Analysis of cell line lysates probed with mouse mAb to GAPDH (theoretical molecular weight: 36 kDa), NB300-221, dilution 1:2,000: [1] protein standard, [2] HEK293, [3] HeLa, [4] SH-SY5Y, [5] COS1, [6] NIH-3T3, and [7] C6 cells. The GAPDH antibody reveals a single band at ~37 kDa in all cell lines. GAPDH is a house keeping protein, the level of which is relatively unaffected by most experimental manipulations, and, as a result, this antibody has been widely used as a western blotting loading control.
GAPDH Antibody (1D4)
NB300-221

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our ADP-Sugar Pyrophosphatase/NUDT5 Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol NUDT5