![Immunocytochemistry/Immunofluorescence: ADPRHL2 Antibody [NBP1-88835] - Staining of human cell line A-431 shows localization to nucleoplasm. Antibody staining is shown in green.](http://images.novusbio.com/fullsize/ADPRHL2-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-88835-img0008.jpg "Immunocytochemistry/Immunofluorescence: ADPRHL2 Antibody [NBP1-88835] - Staining of human cell line A-431 shows localization to nucleoplasm. Antibody staining is shown in green.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: SEHFLKQLLGHMEDLEGDAQSVLDARELGMEERPYSSRLKKIGELLDQASVTREEVVSELGNGIAAFESVPTAIYCFLR |
| Predicted Species | Mouse (91%), Rat (91%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | ADPRHL2 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization, Use PFA/Triton X-100. IHC verified by a customer review. |
||
| Control Peptide |
|
||
| Reviewed Applications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![ST8 alpha-2,8-Sialyltransferase 4/ST8SIA4 [Unconjugated]](/sites/all/modules/enterprise-tech/et_datasheets/images/novus_guarantee.png "ST8 alpha-2,8-Sialyltransferase 4/ST8SIA4 [Unconjugated]")
| Images | Ratings | Applications | Species | Date | Details | ||||
|---|---|---|---|---|---|---|---|---|---|
-(01-ml)_NBP1-88835_6911.jpg)
Enlarge |
reviewed by:
Bryan Tinsley |
IHC | Human | 04/21/2014 |
Summary
|
Secondary Antibodies |
Isotype Controls |
Research Areas for ADPRHL2 Antibody (NBP1-88835)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | ADPRHL2 |
![ADPRHL2 Antibody [NBP1-88835] - Staining of human testis shows strong cytoplasmic and nuclear positivity in cells in seminiferous ducts.](http://images.novusbio.com/fullsize/nbp1-88835_rabbit-polyclonal-adprhl2-antibody-immunohistochemistry-paraffin-2520237418..jpg "ADPRHL2 Antibody [NBP1-88835] - Staining of human testis shows strong cytoplasmic and nuclear positivity in cells in seminiferous ducts.")
![ADPRHL2 Antibody [NBP1-88835] -Staining of human placenta shows strong nuclear and cytoplasmic positivity in trophoblastic cells.](http://images.novusbio.com/fullsize/nbp1-88835_rabbit-polyclonal-adprhl2-antibody-immunohistochemistry-paraffin-25202374325..jpg "ADPRHL2 Antibody [NBP1-88835] -Staining of human placenta shows strong nuclear and cytoplasmic positivity in trophoblastic cells.")
![ADPRHL2 Antibody [NBP1-88835] -Staining of human tonsil shows strong cytoplasmic and membranous positivity in non-germinal center cells.](http://images.novusbio.com/fullsize/nbp1-88835_rabbit-polyclonal-adprhl2-antibody-immunohistochemistry-paraffin-25202374510..jpg "ADPRHL2 Antibody [NBP1-88835] -Staining of human tonsil shows strong cytoplasmic and membranous positivity in non-germinal center cells.")
![Immunohistochemistry Clusterin/APOJ Antibody [Unconjugated]](https://images.novusbio.com/images2/Clusterin_AF2747_Immunohistochemistry_9945.jpg)
![Immunohistochemistry Clusterin/APOJ Antibody [Unconjugated]](https://images.novusbio.com/images2/Clusterin_AF2747_Immunohistochemistry_9946.jpg)
![Western Blot Clusterin/APOJ Antibody [Unconjugated]](https://images.novusbio.com/images/af2747_mouse-clusterin-affinity-purified-polyclonal-ab-4120241240247.jpg)
![Immunohistochemistry LDLR Antibody [Unconjugated]](https://images.novusbio.com/images2/LDL_R_AF2255_Immunohistochemistry_7149.jpg)
![Western Blot LDLR Antibody [Unconjugated]](https://images.novusbio.com/images2/LDLR_AF2255_Western_Blot_23731.jpg)
![Western Blot LDLR Antibody [Unconjugated]](https://images.novusbio.com/images/af2255_mouse-ldl-r-affinity-purified-polyclonal-ab-4120241049445.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")
-(01-ml)_NBP1-88835_6911.jpg)