![Immunohistochemistry-Paraffin: Aconitase 2 Antibody [NBP1-90264] - Staining in human heart muscle and liver tissues using NBP1-90264 antibody. Corresponding ACO2 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/Aconitase-2-Antibody-Immunohistochemistry-Paraffin-NBP1-90264-img0018.jpg "Immunohistochemistry-Paraffin: Aconitase 2 Antibody [NBP1-90264] - Staining in human heart muscle and liver tissues using NBP1-90264 antibody. Corresponding ACO2 RNA-seq data are presented for the same tissues.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: GKKFRLEAPDADELPKGEFDPGQDTYQHPPKDSSGQHVDVSPTSQRLQLLEPFDKWDGKDLEDLQILIKVKGKCTTDHISAAGPWLKFRGHLDNISNNLLIGAINIENGKANSVRNAVTQEFGPVPDTARYYKKHGIRWVVIGDENYGEG |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | ACO2 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Theoretical MW | 85 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for Aconitase 2 Antibody (NBP1-90264)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunohistochemistry: Aconitase 2 Antibody [NBP1-90264] - STED super-resolution microscopy of mitochondria in the rectal Muscularis externa demonstrates high structural preservation of the stored paraffin-embedded tissue. STED recordings were performed on 2 um thick dewaxed sections cut along the longitudinal axis of the rectum. STED images of tissue sections decorated with antisera against aconitase. In each panel the confocal (left) and the corresponding STED image (right) is displayed. Magnification of the STED image as indicated by a dashed square. Scale bar: 200 nm. Image collected and cropped by CiteAb from the following publication (//dx.plos.org/10.1371/journal.pone.0101563), licensed under a CC-BY license.](http://images.novusbio.com/fullsize/Aconitase-2-Antibody-Immunohistochemistry-NBP1-90264-img0013.jpg "Immunohistochemistry: Aconitase 2 Antibody [NBP1-90264] - STED super-resolution microscopy of mitochondria in the rectal Muscularis externa demonstrates high structural preservation of the stored paraffin-embedded tissue. STED recordings were performed on 2 um thick dewaxed sections cut along the longitudinal axis of the rectum. STED images of tissue sections decorated with antisera against aconitase. In each panel the confocal (left) and the corresponding STED image (right) is displayed. Magnification of the STED image as indicated by a dashed square. Scale bar: 200 nm. Image collected and cropped by CiteAb from the following publication (//dx.plos.org/10.1371/journal.pone.0101563), licensed under a CC-BY license.")
![Immunocytochemistry/Immunofluorescence: Aconitase 2 Antibody [NBP1-90264] - Immunofluorescent staining of human cell line U-2 OS shows localization to mitochondria.](http://images.novusbio.com/fullsize/Aconitase-2-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-90264-img0008.jpg "Immunocytochemistry/Immunofluorescence: Aconitase 2 Antibody [NBP1-90264] - Immunofluorescent staining of human cell line U-2 OS shows localization to mitochondria.")
![Western Blot: Aconitase 2 Antibody [NBP1-90264] - Western blot analysis in mouse cell line NIH-3T3, rat cell line NBT-II and rat cell line pC12.](http://images.novusbio.com/fullsize/Aconitase-2-Antibody-Western-Blot-NBP1-90264-img0009.jpg "Western Blot: Aconitase 2 Antibody [NBP1-90264] - Western blot analysis in mouse cell line NIH-3T3, rat cell line NBT-II and rat cell line pC12.")
![Western Blot: Aconitase 2 Antibody [NBP1-90264] - Analysis in human cell line HL-60.](http://images.novusbio.com/fullsize/Aconitase-2-Antibody-Western-Blot-NBP1-90264-img0006.jpg "Western Blot: Aconitase 2 Antibody [NBP1-90264] - Analysis in human cell line HL-60.")
![Immunohistochemistry-Paraffin: Aconitase 2 Antibody [NBP1-90264] - Staining of human duodenum shows strong strong granular cytoplasmic positivity in glandular cells.](http://images.novusbio.com/fullsize/Aconitase-2-Antibody-Immunohistochemistry-Paraffin-NBP1-90264-img0014.jpg "Immunohistochemistry-Paraffin: Aconitase 2 Antibody [NBP1-90264] - Staining of human duodenum shows strong strong granular cytoplasmic positivity in glandular cells.")
![Immunohistochemistry-Paraffin: Aconitase 2 Antibody [NBP1-90264] - Staining of human heart muscle shows strong granular cytoplasmic positivity in cardiomyocytes.](http://images.novusbio.com/fullsize/Aconitase-2-Antibody-Immunohistochemistry-Paraffin-NBP1-90264-img0015.jpg "Immunohistochemistry-Paraffin: Aconitase 2 Antibody [NBP1-90264] - Staining of human heart muscle shows strong granular cytoplasmic positivity in cardiomyocytes.")
![Immunohistochemistry-Paraffin: Aconitase 2 Antibody [NBP1-90264] - Staining of human kidney shows strong strong granular cytoplasmic positivity in cells in tubules.](http://images.novusbio.com/fullsize/Aconitase-2-Antibody-Immunohistochemistry-Paraffin-NBP1-90264-img0016.jpg "Immunohistochemistry-Paraffin: Aconitase 2 Antibody [NBP1-90264] - Staining of human kidney shows strong strong granular cytoplasmic positivity in cells in tubules.")
![Immunohistochemistry-Paraffin: Aconitase 2 Antibody [NBP1-90264] - Staining of human liver shows very weak positivity in hepatocytes as expected.](http://images.novusbio.com/fullsize/Aconitase-2-Antibody-Immunohistochemistry-Paraffin-NBP1-90264-img0017.jpg "Immunohistochemistry-Paraffin: Aconitase 2 Antibody [NBP1-90264] - Staining of human liver shows very weak positivity in hepatocytes as expected.")
![Complement Component C2 Antibody [Unconjugated]](/sites/all/modules/enterprise-tech/et_datasheets/images/novus_guarantee.png "Complement Component C2 Antibody [Unconjugated]")
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")