Home » ABCG4 » ABCG4 Proteins » ABCG4 Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

ABCG4 Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for ABCG4 Protein (NBP2-14252PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

ABCG4 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human ABCG4.

Source: E. coli

Amino Acid Sequence: NPMLFRAVQNGLCAMAEKKSSPEKNEVPAPCPPCPPEVDPIESHTFATSTLT

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
ABCG4
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-14252.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
23 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for ABCG4 Recombinant Protein Antigen

  • ATP-binding cassette, sub-family G (WHITE), member 4
  • ATP-binding cassette, subfamily G, member 4
  • putative ABC transporter
  • WHITE2ATP-binding cassette sub-family G member 4

Background

ABCG4 is encoded by this gene is included in the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the White subfamily and is expressed predominantly in liver tissue. The function has not yet been determined but may involve cholesterol transport. Alternate splice variants have been described but their full length sequences have not been determined.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

ABCG1 Antibody -
BSA Free
NB400-132
Western Blot ABCG1 Antibody - BSA Free
Western Blot ABCG1 Antibody - BSA Free
Western Blot ABCG1 Antibody - BSA Free
(2 Reviews)
(182 Publications)
Species: ChHa, Ha, Hu, Pm, Mu, Rb, Rt
Applications: Flow-IC, Flow, IB, ICC/IF, IHC, IHC-P, IP, In vitro, In vivo, WB
ABCA1 Antibody -
BSA Free
NB400-105
Dual RNAscope ISH-IHC ABCA1 Antibody - BSA Free
Immunohistochemistry-Paraffin ABCA1 Antibody - BSA Free
Western Blot ABCA1 Antibody - BSA Free
(7 Reviews)
(408 Publications)
Species: Ca, Ch, ChHa, Eq, Ha, Hu, Mu, Md, Po, Pm, Rb, Rt
Applications: B/N, ChIP, ChIP, Dual ISH-IHC, ELISA, Flow, GS, GS, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD, KO, PCR, Simple Western, WB
ABCB6 Antibody
NBP1-91642
Immunohistochemistry-Paraffin ABCB6 Antibody
Immunocytochemistry/ Immunofluorescence ABCB6 Antibody
(1 Publication)
Species: Hu
Applications: ICC/IF, IHC, IHC-P
ABCG2/CD338
Antibody (3G8) - BSA
NBP2-22124
ELISA ABCG2/CD338 Antibody (3G8) - BSA Free
Flow Cytometry ABCG2/CD338 Antibody (3G8) - BSA Free
Immunocytochemistry/ Immunofluorescence ABCG2/CD338 Antibody (3G8) - BSA Free
(8 Publications)
Species: Hu, Mu, Pm
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Apolipoprotein
A-I/ApoA1 Antibody - ...
NBP2-52979
Flow Cytometry Apolipoprotein A-I/ApoA1 Antibody - BSA Free
Western Blot Apolipoprotein A-I/ApoA1 Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence Apolipoprotein A-I/ApoA1 Antibody - BSA Free
(1 Review)
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
ABCG8 Antibody
(1B10A5)
NBP1-71706
Immunocytochemistry/ Immunofluorescence ABCG8 Antibody (1B10A5)
Immunohistochemistry ABCG8 Antibody (1B10A5)
Western Blot ABCG8 Antibody (1B10A5)
(1 Review)
(12 Publications)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP, KO, WB
SREBP2 Antibody
(1D2) - BSA Free
NBP1-54446
Western Blot SREBP2 Antibody (1D2) - BSA Free
Immunocytochemistry/ Immunofluorescence SREBP2 Antibody (1D2) - BSA Free
(20 Publications)
Species: Ch, Hu
Applications: ELISA, GS, ICC/IF, IP, WB
SR-BI Antibody -
BSA Free
NB400-104
Immunohistochemistry-Paraffin SR-BI Antibody - BSA Free
Knockdown Validated SR-BI Antibody - BSA Free
Western Blot SR-BI Antibody - BSA Free
(5 Reviews)
(233 Publications)
Species: ChHa, SyHa, Ha, Hu, Mu, Md, Po, Pm, Rb, Rt
Applications: B/N, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD, KO, PLA, Simple Western, WB
Apolipoprotein
E/ApoE Antibody (WUE- ...
NB110-60531
Flow (Intracellular) Apolipoprotein E/ApoE Antibody (WUE-4) - BSA Free
Western Blot Apolipoprotein E/ApoE Antibody (WUE-4) - BSA Free
Flow Cytometry Apolipoprotein E/ApoE Antibody (WUE-4) - BSA Free
(2 Reviews)
(38 Publications)
Species: Hu, Mu, Rt(-)
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-P, IP, WB
ABCA4 Antibody
(3F4)
NBP1-30032
Knockout Validated ABCA4 Antibody (3F4)
Immunohistochemistry ABCA4 Antibody (3F4)
Knockout Validated ABCA4 Antibody (3F4)
(1 Review)
(5 Publications)
Species: Bv, Ca, Fe, Hu, Mu, Xp
Applications: ICC/IF, IHC, IHC-Fr, KO, WB

beta-Galactosidase-1/G ...
NBP2-45731
Western Blot beta-Galactosidase-1/GLB1 Antibody (OTI1C9)
Immunohistochemistry beta-Galactosidase-1/GLB1 Antibody (OTI1C9)
Immunohistochemistry beta-Galactosidase-1/GLB1 Antibody (OTI1C9)
(6 Publications)
Species: Ca, Hu, Pm
Applications: IHC, IHC-P, WB
ABCA2 Antibody
NBP1-20863
Immunohistochemistry-Paraffin ABCA2 Antibody
(3 Publications)
Species: Hu
Applications: IHC, IHC-P, IP, PEP-ELISA, WB
MRP3 Antibody
NBP2-37923
Immunocytochemistry/ Immunofluorescence MRP3 Antibody
Immunohistochemistry-Paraffin MRP3 Antibody
Immunohistochemistry-Paraffin MRP3 Antibody
Species: Hu
Applications: ICC/IF, IHC, IHC-P
CFTR Antibody
(24-1) [Unconjugated] ...
MAB25031
Immunohistochemistry CFTR Antibody (24-1) [Unconjugated] - C-terminus
Immunohistochemistry CFTR Antibody (24-1) [Unconjugated] - C-terminus
Immunoprecipitation CFTR Antibody (24-1) [Unconjugated] - C-terminus
(10 Reviews)
(76 Publications)
Species: Hu
Applications: IHC, IP, WB
ABCD1 Antibody
(OTI2C12)
NBP2-46476
Knockdown Validated ABCD1 Antibody (OTI2C12)
Immunohistochemistry ABCD1 Antibody (OTI2C12)
Immunohistochemistry ABCD1 Antibody (OTI2C12)
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, KD, KO, WB
ABCG4 Recombinant
Protein Antigen
NBP2-14252PEP
ABCG4 Recombinant Protein Antigen
Species: Hu
Applications: AC

Publications for ABCG4 Protein (NBP2-14252PEP) (0)

There are no publications for ABCG4 Protein (NBP2-14252PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ABCG4 Protein (NBP2-14252PEP) (0)

There are no reviews for ABCG4 Protein (NBP2-14252PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for ABCG4 Protein (NBP2-14252PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional ABCG4 Products

Array NBP2-14252PEP

Research Areas for ABCG4 Protein (NBP2-14252PEP)

Find related products by research area.

Blogs on ABCG4.

Check out the latest blog posts on ABCG4.
ABCG2: A Tumor Protector
ABCG2 is a member of the ATP-binding cassette (ABC) transporter superfamily. Among ABC transporters ABCG2 is particularly interesting for its potential role in protecting cancer stem cells and its complex oligomeric structure (1). The ABC transporters...  Read full blog post.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Formalin-fixed paraffin-embedded tissue sections of human prostate cancer were probed for ABCA1 mRNA (ACD RNAScope Probe, catalog # 432291; Fast Red chromogen, ACD catalog # 322360). Adjacent tissue section was processed for immunohistochemistry using rabbit polyclonal (Novus Biologicals catalog # NB400-105) at 1.5ug/mL with overnight incubation at 4 degrees Celsius followed by incubation with anti-rabbit IgG VisUCyte HRP Polymer Antibody (Catalog # VC003) and DAB chromogen (yellow-brown). Tissue was counterstained with hematoxylin (blue). Specific staining was localized to glandular cells.
ABCA1 Antibody - BSA Free
NB400-105
Immunohistochemistry-Paraffin: SR-BI Antibody [NB400-104] - Staining of human adrenal cortex.
SR-BI Antibody - BSA Free
NB400-104

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our ABCG4 Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol ABCG4