![Immunohistochemistry-Paraffin: ABCF2 Antibody [NBP1-89317] - Staining in human testis and liver tissues using anti-ABCF2 antibody. Corresponding ABCF2 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/ABCF2-Antibody-Immunohistochemistry-Paraffin-NBP1-89317-img0010.jpg "Immunohistochemistry-Paraffin: ABCF2 Antibody [NBP1-89317] - Staining in human testis and liver tissues using anti-ABCF2 antibody. Corresponding ABCF2 RNA-seq data are presented for the same tissues.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: KEAAKARQRPRKGHEENGDVVTEPQVAEKNEANGRETTEVDLLTKELEDFEMKKAAARAVTGVLASHPNSTDVHIINLSLTFHGQELLSDTKLELNSGRRYGLIGLNGIGKS |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | ABCF2 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for ABCF2 Antibody (NBP1-89317)Find related products by research area.
|
|
Cancer studies with ABCF2 ATP-binding cassette superfamily F2 (ABCF2) is a member of the ATP-binding cassette (ABC) transporter superfamily, and more specifically, a member of the GCN20 subfamily. Most members of this family are membrane proteins that transport various substra... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | ABCF2 |
![Western Blot: ABCF2 Antibody [NBP1-89317] - Analysis using Anti-ABCF2 antibody NBP1-89317 (A) shows similar pattern to independent antibody NBP1-89316 (B).](http://images.novusbio.com/fullsize/ABCF2-Antibody-Western-Blot-NBP1-89317-img0011.jpg "Western Blot: ABCF2 Antibody [NBP1-89317] - Analysis using Anti-ABCF2 antibody NBP1-89317 (A) shows similar pattern to independent antibody NBP1-89316 (B).")
![Immunocytochemistry/Immunofluorescence: ABCF2 Antibody [NBP1-89317] - Immunofluorescent staining of human cell line A-431 shows localization to cytosol.](http://images.novusbio.com/fullsize/ABCF2-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-89317-img0006.jpg "Immunocytochemistry/Immunofluorescence: ABCF2 Antibody [NBP1-89317] - Immunofluorescent staining of human cell line A-431 shows localization to cytosol.")
![Western Blot: ABCF2 Antibody [NBP1-89317] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).](http://images.novusbio.com/fullsize/ABCF2-Antibody-Western-Blot-NBP1-89317-img0005.jpg "Western Blot: ABCF2 Antibody [NBP1-89317] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).")
![Immunohistochemistry-Paraffin: ABCF2 Antibody [NBP1-89317] - Staining of human liver shows low expression as expected.](http://images.novusbio.com/fullsize/ABCF2-Antibody-Immunohistochemistry-Paraffin-NBP1-89317-img0008.jpg "Immunohistochemistry-Paraffin: ABCF2 Antibody [NBP1-89317] - Staining of human liver shows low expression as expected.")
![Immunohistochemistry-Paraffin: ABCF2 Antibody [NBP1-89317] - Staining of human testis shows high expression.](http://images.novusbio.com/fullsize/ABCF2-Antibody-Immunohistochemistry-Paraffin-NBP1-89317-img0009.jpg "Immunohistochemistry-Paraffin: ABCF2 Antibody [NBP1-89317] - Staining of human testis shows high expression.")
![Immunocytochemistry Progesterone R/NR3C3 Antibody [Unconjugated]](https://images.novusbio.com/images2/Progesterone_R_AF5415_Immunocytochemistry__Immunofluorescence_20674.jpg)
![Immunohistochemistry Progesterone R/NR3C3 Antibody [Unconjugated]](https://images.novusbio.com/images2/Progesterone_R_AF5415_Immunohistochemistry_20779.jpg)
![Western Blot Progesterone R/NR3C3 Antibody [Unconjugated]](https://images.novusbio.com/images2/Progesterone_R_AF5415_Western_Blot_5715.jpg)
![Immunohistochemistry CFTR Antibody (24-1) [Unconjugated] - C-terminus](https://images.novusbio.com/images2/CFTR_MAB25031_Immunohistochemistry_6973.jpg)
![Immunohistochemistry CFTR Antibody (24-1) [Unconjugated] - C-terminus](https://images.novusbio.com/images2/CFTR_MAB25031_Immunohistochemistry_9671.jpg)
![Immunoprecipitation CFTR Antibody (24-1) [Unconjugated] - C-terminus](https://images.novusbio.com/images/mab25031_human-cftr-c-terminus-mab-clone-24-1-41202412513815.jpg)
![Flow Cytometry Claudin-4 Antibody (382321) [Unconjugated]](https://images.novusbio.com/images2/Claudin4_MAB4219_Flow_Cytometry_21352.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")