![Immunocytochemistry/Immunofluorescence: ZC3H14 Antibody [NBP2-49087] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoli & nuclear speckles.](http://images.novusbio.com/fullsize/ZC3H14-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-49087-img0003.jpg "Immunocytochemistry/Immunofluorescence: ZC3H14 Antibody [NBP2-49087] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoli & nuclear speckles.")
| Reactivity | HuSpecies Glossary |
| Applications | ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: LILKAISEAQESVTKTTNYSTVPQKQTLPVAPRTRTSQEELLAEVVQGQSRTPRISPPIKEEETKGDSVEKNQGTQQRQLLSRLQIDPVMA |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | ZC3H14 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | ZC3H14 |
![Immunohistochemistry-Paraffin: ZC3H14 Antibody [NBP2-49087] - Staining of human colon.](http://images.novusbio.com/fullsize/ZC3H14-Antibody-Immunohistochemistry-Paraffin-NBP2-49087-img0010.jpg "Immunohistochemistry-Paraffin: ZC3H14 Antibody [NBP2-49087] - Staining of human colon.")
![Immunohistochemistry-Paraffin: ZC3H14 Antibody [NBP2-49087] - Staining of human bronchus shows strong nuclear positivity in respiratory epithelial cells.](http://images.novusbio.com/fullsize/ZC3H14-Antibody-Immunohistochemistry-Paraffin-NBP2-49087-img0002.jpg "Immunohistochemistry-Paraffin: ZC3H14 Antibody [NBP2-49087] - Staining of human bronchus shows strong nuclear positivity in respiratory epithelial cells.")
![Immunohistochemistry-Paraffin: ZC3H14 Antibody [NBP2-49087] - Staining of human skeletal muscle shows low expression as expected.](http://images.novusbio.com/fullsize/ZC3H14-Antibody-Immunohistochemistry-Paraffin-NBP2-49087-img0004.jpg "Immunohistochemistry-Paraffin: ZC3H14 Antibody [NBP2-49087] - Staining of human skeletal muscle shows low expression as expected.")
![Immunohistochemistry-Paraffin: ZC3H14 Antibody [NBP2-49087] - Staining of human testis shows high expression.](http://images.novusbio.com/fullsize/ZC3H14-Antibody-Immunohistochemistry-Paraffin-NBP2-49087-img0005.jpg "Immunohistochemistry-Paraffin: ZC3H14 Antibody [NBP2-49087] - Staining of human testis shows high expression.")
![Immunohistochemistry-Paraffin: ZC3H14 Antibody [NBP2-49087] - Staining in human testis and skeletal muscle tissues using anti-ZC3H14 antibody. Corresponding ZC3H14 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/ZC3H14-Antibody-Immunohistochemistry-Paraffin-NBP2-49087-img0006.jpg "Immunohistochemistry-Paraffin: ZC3H14 Antibody [NBP2-49087] - Staining in human testis and skeletal muscle tissues using anti-ZC3H14 antibody. Corresponding ZC3H14 RNA-seq data are presented for the same tissues.")
![Immunohistochemistry-Paraffin: ZC3H14 Antibody [NBP2-49087] - Staining of human colon, kidney, liver and testis using Anti-ZC3H14 antibody NBP2-49087 (A) shows similar protein distribution across tissues to independent antibody NBP2-13537 (B).](http://images.novusbio.com/fullsize/ZC3H14-Antibody-Immunohistochemistry-Paraffin-NBP2-49087-img0007.jpg "Immunohistochemistry-Paraffin: ZC3H14 Antibody [NBP2-49087] - Staining of human colon, kidney, liver and testis using Anti-ZC3H14 antibody NBP2-49087 (A) shows similar protein distribution across tissues to independent antibody NBP2-13537 (B).")
![Immunohistochemistry-Paraffin: ZC3H14 Antibody [NBP2-49087] - Staining of human liver.](http://images.novusbio.com/fullsize/ZC3H14-Antibody-Immunohistochemistry-Paraffin-NBP2-49087-img0008.jpg "Immunohistochemistry-Paraffin: ZC3H14 Antibody [NBP2-49087] - Staining of human liver.")
![Immunohistochemistry-Paraffin: ZC3H14 Antibody [NBP2-49087] - Staining of human kidney.](http://images.novusbio.com/fullsize/ZC3H14-Antibody-Immunohistochemistry-Paraffin-NBP2-49087-img0009.jpg "Immunohistochemistry-Paraffin: ZC3H14 Antibody [NBP2-49087] - Staining of human kidney.")
![Immunohistochemistry-Paraffin: ZC3H14 Antibody [NBP2-49087] - Staining of human testis using Anti-ZC3H14 antibody NBP2-49087.](http://images.novusbio.com/fullsize/ZC3H14-Antibody-Immunohistochemistry-Paraffin-NBP2-49087-img0011.jpg "Immunohistochemistry-Paraffin: ZC3H14 Antibody [NBP2-49087] - Staining of human testis using Anti-ZC3H14 antibody NBP2-49087.")
![Western Blot ID1 Antibody [Unconjugated]](https://images.novusbio.com/images2/ID1_AF4377_Western_Blot_5453.jpg)
![Immunocytochemistry ID1 Antibody [Unconjugated]](https://images.novusbio.com/images2/ID1_AF4377_Immunocytochemistry_12849.jpg)
![Simple Western ID1 Antibody [Unconjugated]](https://images.novusbio.com/images2/af4377_human-mouse-id1-affinity-purified-polyclonal-ab-simple-western-482021152036.jpg)
![Flow Cytometry CD1b Antibody (737249) [Unconjugated]](https://images.novusbio.com/images2/CD1b_MAB7446_Flow_Cytometry_12185.jpg)
![SDS-PAGE LIGHT/TNFSF14 [Unconjugated]](https://images.novusbio.com/images2/LIGHT_664-LI_719.jpg)
![Bioactivity LIGHT/TNFSF14 [Unconjugated]](https://images.novusbio.com/images2/LIGHT_664-LI_721.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")