![Immunohistochemistry-Paraffin: ZC3H14 Antibody [NBP2-13537] - Analysis in human testis and liver tissues using NBP2-13537 antibody. Corresponding ZC3H14 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/ZC3H14-Antibody-Immunohistochemistry-Paraffin-NBP2-13537-img0019.jpg "Immunohistochemistry-Paraffin: ZC3H14 Antibody [NBP2-13537] - Analysis in human testis and liver tissues using NBP2-13537 antibody. Corresponding ZC3H14 RNA-seq data are presented for the same tissues.")
| Reactivity | Hu, MuSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against a recombinant protein corresponding to the amino acids: RPSIEIYRPPASRNADSGVHLNRLQFQQQQNSIHAAKQLDMQSSWVYETGRLCEPEVLNSLEETYSPFFRNNSEKMSMEDENFRKRKLPVVSSVVKVK |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | ZC3H14 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. For ICC/IF Fixation/Permeabilization: PFA/Triton X-100. |
||
| Control Peptide |
|
||
| Reviewed Applications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
| Images | Ratings | Applications | Species | Date | Details | ||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
|
reviewed by:
Samih Alqawlaq |
WB | Mouse | 06/12/2018 |
Summary
Comments
|
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | ZC3H14 |
![Immunohistochemistry-Paraffin: ZC3H14 Antibody [NBP2-13537] - Staining of human colon, kidney, liver and testis using Anti-ZC3H14 antibody NBP2-13537 (A) shows similar protein distribution across tissues to independent antibody NBP2-49087 (B).](http://images.novusbio.com/fullsize/ZC3H14-Antibody-Immunohistochemistry-Paraffin-NBP2-13537-img0011.jpg "Immunohistochemistry-Paraffin: ZC3H14 Antibody [NBP2-13537] - Staining of human colon, kidney, liver and testis using Anti-ZC3H14 antibody NBP2-13537 (A) shows similar protein distribution across tissues to independent antibody NBP2-49087 (B).")
![Western Blot: ZC3H14 Antibody [NBP2-13537] - Analysis in human cell line RH-30.](http://images.novusbio.com/fullsize/ZC3H14-Antibody-Western-Blot-NBP2-13537-img0017.jpg "Western Blot: ZC3H14 Antibody [NBP2-13537] - Analysis in human cell line RH-30.")
![Immunocytochemistry/Immunofluorescence: ZC3H14 Antibody [NBP2-13537] - Staining of human cell line MCF7 shows localization to nuclear speckles. Antibody staining is shown in green.](http://images.novusbio.com/fullsize/ZC3H14-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-13537-img0004.jpg "Immunocytochemistry/Immunofluorescence: ZC3H14 Antibody [NBP2-13537] - Staining of human cell line MCF7 shows localization to nuclear speckles. Antibody staining is shown in green.")
![Immunohistochemistry-Paraffin: ZC3H14 Antibody [NBP2-13537] - Staining of human liver shows no nuclear positivity in hepatocytes as expected.](http://images.novusbio.com/fullsize/ZC3H14-Antibody-Immunohistochemistry-Paraffin-NBP2-13537-img0023.jpg "Immunohistochemistry-Paraffin: ZC3H14 Antibody [NBP2-13537] - Staining of human liver shows no nuclear positivity in hepatocytes as expected.")
![Immunohistochemistry-Paraffin: ZC3H14 Antibody [NBP2-13537] - Staining of human testis shows strong nuclear positivity in cells in seminiferous ducts.](http://images.novusbio.com/fullsize/ZC3H14-Antibody-Immunohistochemistry-Paraffin-NBP2-13537-img0020.jpg "Immunohistochemistry-Paraffin: ZC3H14 Antibody [NBP2-13537] - Staining of human testis shows strong nuclear positivity in cells in seminiferous ducts.")
![Immunohistochemistry-Paraffin: ZC3H14 Antibody [NBP2-13537] - Staining of human colon shows strong nuclear positivity in glandular cells.](http://images.novusbio.com/fullsize/ZC3H14-Antibody-Immunohistochemistry-Paraffin-NBP2-13537-img0021.jpg "Immunohistochemistry-Paraffin: ZC3H14 Antibody [NBP2-13537] - Staining of human colon shows strong nuclear positivity in glandular cells.")
![Immunohistochemistry-Paraffin: ZC3H14 Antibody [NBP2-13537] - Staining of human kidney shows moderate nuclear positivity in cells in tubules.](http://images.novusbio.com/fullsize/ZC3H14-Antibody-Immunohistochemistry-Paraffin-NBP2-13537-img0022.jpg "Immunohistochemistry-Paraffin: ZC3H14 Antibody [NBP2-13537] - Staining of human kidney shows moderate nuclear positivity in cells in tubules.")
![Western Blot ID1 Antibody [Unconjugated]](https://images.novusbio.com/images2/ID1_AF4377_Western_Blot_5453.jpg)
![Immunocytochemistry ID1 Antibody [Unconjugated]](https://images.novusbio.com/images2/ID1_AF4377_Immunocytochemistry_12849.jpg)
![Simple Western ID1 Antibody [Unconjugated]](https://images.novusbio.com/images2/af4377_human-mouse-id1-affinity-purified-polyclonal-ab-simple-western-482021152036.jpg)
![Flow Cytometry CD1b Antibody (737249) [Unconjugated]](https://images.novusbio.com/images2/CD1b_MAB7446_Flow_Cytometry_12185.jpg)
![SDS-PAGE LIGHT/TNFSF14 [Unconjugated]](https://images.novusbio.com/images2/LIGHT_664-LI_719.jpg)
![Bioactivity LIGHT/TNFSF14 [Unconjugated]](https://images.novusbio.com/images2/LIGHT_664-LI_721.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")
