Home » XRCC2 » XRCC2 Proteins » XRCC2 Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

XRCC2 Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for XRCC2 Recombinant Protein Antigen (NBP2-56170PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

XRCC2 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human XRCC2.

Source: E. coli

Amino Acid Sequence: AQLVNGVGGGKVESLLRRAFGAMCSAFHRAESGTELLARLEGRSSLKEIEPNLFADEDSPVHGDILEFHGPEGTGKTEMLYHLTARCILPKSEGGLEVEVLFIDTDYHFDMLRLVTILEHRLSQSSEEIIKYC

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
XRCC2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-56170.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

For further blocking tide related information and a protocol, click here.
Theoretical MW
32 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for XRCC2 Recombinant Protein Antigen

  • DKFZp781P0919
  • DNA repair protein XRCC2
  • X-ray repair complementing defective repair in Chinese hamster cells 2
  • X-ray repair cross-complementing protein 2
  • X-ray repair, complementing defective, repair in Chinese hamster

Background

RAD51 is a eukaryotic homologue of E. coli RecA, a recombinase, and a component of the homologous recombination DNA repair pathway. RAD51 forms a nucleoprotein filament (through binding RAD52 and single stranded DNA that are exposed following double strand breaks) that initiates recombination. There are five human homologues of RAD51; XRCC2, XRCC3, RAD51B, RAD51C, RAD51D, and they interact among themselves to form one big complex or several smaller complexes. XRCC2 (X Ray Repair Cross Complementing 2), a component of the homologous recombination pathway, is essential for repairing the double strand DNA breaks by homologous recombination between sister chromatids.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

Rad51 Antibody
(14B4)
NB100-148
Western Blot Rad51 Antibody (14B4)
Western Blot Rad51 Antibody (14B4)
Western Blot Rad51 Antibody (14B4)
(5 Reviews)
(65 Publications)
Species: Ch, Hu, Mu, Rt
Applications: ChIP, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro, KD, PLA, WB
XRCC3 Antibody -
BSA Free
NB100-165
Western Blot XRCC3 Antibody - BSA Free
Western Blot XRCC3 Antibody - BSA Free
(1 Review)
(18 Publications)
Species: Dr, Ha, Hu
Applications: ICC/IF (-), IP, WB
Rad51D Antibody
(5B3/6)
NB100-178
Western Blot Rad51D Antibody (5B3/6)
Immunocytochemistry/ Immunofluorescence Rad51D Antibody (5B3/6)
(3 Publications)
Species: Hu, Mu(-)
Applications: ICC/IF, WB
Rad51C Antibody
(2H11/6) - BSA Free
NB100-177
Western Blot Rad51C Antibody (2H11/6) - BSA Free
Western Blot Rad51C Antibody (2H11/6) - BSA Free
Flow Cytometry Rad51C Antibody (2H11/6) - BSA Free
(38 Publications)
Species: Hu, Mu, Pm, Ye
Applications: CyTOF-ready, Flow, ICC/IF, IHC, IHC-P, IP, Simple Western, WB
Rad51L1 Antibody
(1 H3/13) - BSA Free
NB100-176
Western Blot Rad51L1 Antibody (1 H3/13) - BSA Free
(3 Publications)
Species: Hu, Mu(-), Pm
Applications: ICC/IF, WB
XRCC1 Antibody
NBP1-87154
Immunohistochemistry-Paraffin XRCC1 Antibody
Immunohistochemistry-Paraffin XRCC1 Antibody
Immunohistochemistry-Paraffin XRCC1 Antibody
(5 Publications)
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
BRCA2 Antibody
(234403) [Unconjugate
MAB2476
Western Blot BRCA2 Antibody (234403) [Unconjugated]
Immunohistochemistry BRCA2 Antibody (234403) [Unconjugated]
Western Blot BRCA2 Antibody (234403) [Unconjugated]
(13 Publications)
Species: Hu
Applications: IHC, WB
XPF Antibody
(OTI4E11)
NBP2-01020
Flow Cytometry XPF Antibody (OTI4E11)
Western Blot XPF Antibody (OTI4E11)
Immunohistochemistry-Paraffin XPF Antibody (OTI4E11)
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
ERCC1 Antibody
(8F1) - BSA Free
NB500-704
Immunohistochemistry-Paraffin ERCC1 Antibody (8F1) - BSA Free
Immunohistochemistry-Paraffin ERCC1 Antibody (8F1) - BSA Free
Immunohistochemistry-Paraffin ERCC1 Antibody (8F1) - BSA Free
(1 Review)
(17 Publications)
Species: ChHa, Hu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
XPD Antibody
AF3296
Western Blot XPD Antibody
(1 Publication)
Species: Hu, Mu, Rt
Applications: WB
DNA Ligase IV
Antibody
NBP2-16182
Western Blot DNA Ligase IV Antibody
Immunohistochemistry-Paraffin DNA Ligase IV Antibody
Immunocytochemistry/ Immunofluorescence DNA Ligase IV Antibody
(1 Publication)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
RAD52 Antibody
NBP2-58116
Western Blot RAD52 Antibody
Immunocytochemistry/ Immunofluorescence RAD52 Antibody
(1 Review)
(1 Publication)
Species: Hu
Applications: ICC/IF, KD, WB
p53 Antibody (PAb
240) - BSA Free
NB200-103
Flow Cytometry p53 Antibody (PAb 240) - BSA Free
Flow Cytometry p53 Antibody (PAb 240) - BSA Free
Flow (Intracellular) p53 Antibody (PAb 240) - BSA Free
(3 Reviews)
(42 Publications)
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
IRS1 Antibody
NB100-82001
Immunohistochemistry-Paraffin IRS1 Antibody
Western Blot IRS1 Antibody
Immunocytochemistry/ Immunofluorescence IRS1 Antibody
(4 Publications)
Species: Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Nbs1 Antibody
NB100-143
Knockout Validated Nbs1 Antibody
Western Blot Nbs1 Antibody
Knockdown Validated Nbs1 Antibody
(8 Reviews)
(203 Publications)
Species: Ha, Hu, Ma, Mu, Pm
Applications: ChIP, ChIP, ELISA, Flow, IB, ICC/IF, IHC, IHC-P, IP, ISH, KD, KO, PAGE, WB
Ku80/XRCC5
Antibody - BSA Free
NB100-508
Western Blot Ku80/XRCC5 Antibody - BSA Free
Immunoprecipitation Ku80/XRCC5 Antibody - BSA Free
Western Blot Ku80/XRCC5 Antibody - BSA Free
(1 Review)
(5 Publications)
Species: Ha, Hu, Mu, Rt
Applications: ChIP, IP, WB
ATRX Antibody
NBP1-83077
Immunohistochemistry-Paraffin ATRX Antibody
Immunohistochemistry-Paraffin ATRX Antibody
Immunohistochemistry-Paraffin ATRX Antibody
(26 Publications)
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
XPG Antibody
NB100-74611
Immunoprecipitation XPG Antibody
Western Blot XPG Antibody
Immunohistochemistry-Paraffin XPG Antibody
(5 Publications)
Species: Hu
Applications: ICC/IF, IHC, IHC-P, IP, WB
BRCA1 Antibody
(RAY) - BSA Free
NB100-598
Western Blot BRCA1 Antibody (RAY) - BSA Free
Immunocytochemistry/ Immunofluorescence BRCA1 Antibody (RAY) - BSA Free
Flow Cytometry BRCA1 Antibody (RAY) - BSA Free
(6 Publications)
Species: Hu
Applications: CyTOF-ready, Flow, ICC/IF, IP, WB
ATM Antibody (2C1)
NB100-309
Knockdown Validated ATM Antibody (2C1)
Knockdown Validated ATM Antibody (2C1)
Immunoprecipitation ATM Antibody (2C1)
(3 Reviews)
(131 Publications)
Species: Hu, Pm, Mu, Rt
Applications: ChIP, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, KD, PAGE, Single-Cell Western, WB

Publications for XRCC2 Recombinant Protein Antigen (NBP2-56170PEP) (0)

There are no publications for XRCC2 Recombinant Protein Antigen (NBP2-56170PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for XRCC2 Recombinant Protein Antigen (NBP2-56170PEP) (0)

There are no reviews for XRCC2 Recombinant Protein Antigen (NBP2-56170PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for XRCC2 Recombinant Protein Antigen (NBP2-56170PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional XRCC2 Products

Research Areas for XRCC2 Recombinant Protein Antigen (NBP2-56170PEP)

Find related products by research area.

Blogs on XRCC2

There are no specific blogs for XRCC2, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Knockout Validated: Nbs1 Antibody [NB100-143] - Lysates of HeLa human cervical epithelial carcinoma parental cell line and Nbs1 knockout (KO) HeLa cell line. PVDF membrane was probed with 1:1000 of Rabbit Anti-Human Polyclonal [NB100-143] followed by HRP-conjugated Anti-Rabbit IgG Secondary Antibody (HAF008). Specific band was detected for Nbs1 at approximately 95 kDa (as indicated) in the parental HeLa cell line, but is not detectable in the knockout HeLa cell line. This experiment was conducted under reducing conditions.
Nbs1 Antibody
NB100-143
Knockdown Validated: ATM Antibody (2C1) [NB100-309] - Non-transfected (-) and transfected (+) HeLa whole cell extracts (60 ug) were separated by 5% SDS-PAGE, and the membrane was blotted with ATM antibody (2C1) [NB100-309] diluted at 1:500.
ATM Antibody (2C1)
NB100-309

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our XRCC2 Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol XRCC2