![Western Blot: Wnt-5b Antibody [NBP3-10544] - Western blot analysis using NBP3-10544 on Human Small Intestine as a positive control. Antibody Titration: 0.2-1 ug/ml](http://images.novusbio.com/fullsize/Wnt-5b-Antibody-Western-Blot-NBP3-10544-img0001.jpg "Western Blot: Wnt-5b Antibody [NBP3-10544] - Western blot analysis using NBP3-10544 on Human Small Intestine as a positive control. Antibody Titration: 0.2-1 ug/ml")
| Reactivity | HuSpecies Glossary |
| Applications | WB, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Concentration | 0.5 mg/ml |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human Wnt-5b (NP_110402). Peptide sequence YCLRNESTGSLGTQGRLCNKTSEGMDGCELMCCGRGYNQFKSVQVERCHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | WNT5B |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Theoretical MW | 39 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS, 2% Sucrose |
| Preservative | 0.09% Sodium Azide |
| Concentration | 0.5 mg/ml |
| Purity | Affinity purified |
![Wnt-2b Antibody [Unconjugated]](/sites/all/modules/enterprise-tech/et_datasheets/images/novus_guarantee.png "Wnt-2b Antibody [Unconjugated]")
![Western Blot beta-Catenin Antibody [Unconjugated]](https://images.novusbio.com/images2/beta-Catenin_AF1329_Western_Blot_5100.jpg)
![Chromatin Immunoprecipitation (ChIP) beta-Catenin Antibody [Unconjugated]](https://images.novusbio.com/images2/beta-Catenin_AF1329_Chromatin_Immunoprecipitation_11251.jpg)
![Simple Western beta-Catenin Antibody [Unconjugated]](https://images.novusbio.com/images2/betaCatenin_AF1329_Simple_Western_17134.jpg)
Secondary Antibodies |
Isotype Controls |
Research Areas for Wnt-5b Antibody (NBP3-10544)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | WNT5B |
![Bioactivity Wnt-5a [Unconjugated]](https://images.novusbio.com/images/protein/645-wn_recombinant-human-mouse-wnt-5a-protein-bioactivity-1612202094911.jpg)
![Western Blot Wnt-7b Antibody [Unconjugated]](https://images.novusbio.com/images2/Wnt-7b_AF3460_Western_Blot_11133.jpg)
![Immunohistochemistry Wnt-7b Antibody [Unconjugated]](https://images.novusbio.com/images/antibody/af3460_human-wnt-7b-affinity-purified-polyclonal-ab-immunohistochemistry-12122023155533..jpg)
![Western Blot Wnt-7b Antibody [Unconjugated]](https://images.novusbio.com/images/af3460_human-wnt-7b-affinity-purified-polyclonal-ab-41202413392421.jpg)
![Bioactivity Wnt-3a [Unconjugated]](https://images.novusbio.com/images2/Wnt3a_5036WN_2880.jpg)
![Bioactivity Wnt-3a [Unconjugated]](https://images.novusbio.com/images2/5036-wn_recombinant-human-wnt-3a-protein-bioactivity-3112023115329.jpg)
![Cell Culture Wnt-3a [Unconjugated]](https://images.novusbio.com/images/5036-wn_recombinant-human-wnt-3a-protein-bioactivity-252023103514.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
