![Western Blot: Wnt-5a Antibody (3P2E8) [NBP3-15684] - Western blot analysis of extracts of various cell lines, using Wnt-5a antibody (NBP3-15684) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 10s.](http://images.novusbio.com/fullsize/Wnt-5a-Antibody-3P2E8-Western-Blot-NBP3-15684-img0002.jpg "Western Blot: Wnt-5a Antibody (3P2E8) [NBP3-15684] - Western blot analysis of extracts of various cell lines, using Wnt-5a antibody (NBP3-15684) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 10s.")
| Reactivity | HuSpecies Glossary |
| Applications | WB, IHC |
| Clone | 3P2E8 |
| Clonality | Monoclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Additional Information | Recombinant Monoclonal Antibody |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 281-380 of human Wnt-5a (P41221). RGKLVQVNSRFNSPTTQDLVYIDPSPDYCVRNESTGSLGTQGRLCNKTSEGMDGCELMCCGRGYDQFKTVQTERCHCKFHWCCYVKCKKCTEIVDQFVCK |
| Isotype | IgG |
| Clonality | Monoclonal |
| Host | Rabbit |
| Gene | WNT5A |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Storage | Store at -20C. Avoid freeze-thaw cycles. |
| Buffer | PBS, 0.05% BSA, 50% glycerol, pH7.3 |
| Preservative | 0.02% Sodium Azide |
| Purity | Affinity purified |
![Western Blot beta-Catenin Antibody [Unconjugated]](https://images.novusbio.com/images2/beta-Catenin_AF1329_Western_Blot_5100.jpg)
![Chromatin Immunoprecipitation (ChIP) beta-Catenin Antibody [Unconjugated]](https://images.novusbio.com/images2/beta-Catenin_AF1329_Chromatin_Immunoprecipitation_11251.jpg)
![Simple Western beta-Catenin Antibody [Unconjugated]](https://images.novusbio.com/images2/betaCatenin_AF1329_Simple_Western_17134.jpg)
Secondary Antibodies |
Isotype Controls |
Research Areas for Wnt-5a Antibody (NBP3-15684)Find related products by research area.
|
|
The role of Wnts in neuroinflammation By Michalina Hanzel, PhDThe multifaceted roles of the Wnt family of glycoproteins have been extensively characterized throughout embryonic development and adult homeostasis. The highly conserved, cell- and tissue- s... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | WNT5A |
![Immunohistochemistry-Paraffin: Wnt-5a Antibody (3P2E8) [NBP3-15684] - Immunohistochemistry of paraffin-embedded human lung cancer using Wnt-5a Rabbit mAb (NBP3-15684) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.](http://images.novusbio.com/fullsize/Wnt-5a-Antibody-3P2E8-Immunohistochemistry-Paraffin-NBP3-15684-img0001.jpg "Immunohistochemistry-Paraffin: Wnt-5a Antibody (3P2E8) [NBP3-15684] - Immunohistochemistry of paraffin-embedded human lung cancer using Wnt-5a Rabbit mAb (NBP3-15684) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.")
![Bioactivity Wnt-3a [Unconjugated]](https://images.novusbio.com/images2/Wnt3a_5036WN_2880.jpg)
![Bioactivity Wnt-3a [Unconjugated]](https://images.novusbio.com/images2/5036-wn_recombinant-human-wnt-3a-protein-bioactivity-3112023115329.jpg)
![Cell Culture Wnt-3a [Unconjugated]](https://images.novusbio.com/images/5036-wn_recombinant-human-wnt-3a-protein-bioactivity-252023103514.jpg)
![Bioactivity Wnt-5a [Unconjugated]](https://images.novusbio.com/images/protein/645-wn_recombinant-human-mouse-wnt-5a-protein-bioactivity-1612202094911.jpg)
![Western Blot ROR2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ROR2_AF2064_Western_Blot_11177.jpg)
![Simple Western ROR2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ROR2_AF2064_Simple_Western_16763.jpg)
![Bioactivity Sonic Hedgehog/Shh [Unconjugated]](https://images.novusbio.com/images2/Sonic_Hedgehog_464SH_2840.jpg)
![SDS-PAGE Sonic Hedgehog/Shh [Unconjugated]](https://images.novusbio.com/images2/Sonic_Hedgehog_464-SH_341.jpg)
![SEC-MALS Sonic Hedgehog/Shh [Unconjugated]](https://images.novusbio.com/images/464-sh_recombinant-mouse-sonic-hedgehog-shh-c25ii-n-terminus-sec-mals-642023224324.jpg)
![SDS-PAGE BMP-4 [Unconjugated]](https://images.novusbio.com/images2/BMP-4_314-BP_100.jpg)
![Bioactivity BMP-4 [Unconjugated]](https://images.novusbio.com/images2/314-bp_recombinant-human-bmp-4-protein-1882021123744.jpg)
![Cell Culture Dkk-1 [Unconjugated]](https://images.novusbio.com/images/5439-dk_recombinant-human-dkk-1-protein-105202416017.jpg)
![Cell Culture Dkk-1 [Unconjugated]](https://images.novusbio.com/images/5439-dk_recombinant-human-dkk-1-protein-cell-culture-105202416211..jpg)
![Bioactivity Dkk-1 [Unconjugated]](https://images.novusbio.com/images/5439-dk_recombinant-human-dkk-1-protein-bioactivity-135202491415..jpg)
![Western Blot JNK1 Antibody (228601) [Unconjugated]](https://images.novusbio.com/images2/JNK1_MAB17761_Western_Blot_5991.jpg)
![Western Blot JNK1 Antibody (228601) [Unconjugated]](https://images.novusbio.com/images2/JNK1_MAB17761_Western_Blot_6327.jpg)
![Immunocytochemistry JNK1 Antibody (228601) [Unconjugated]](https://images.novusbio.com/images2/JNK1_MAB17761_Immunocytochemistry__Immunofluorescence_20184.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")