Western Blot: ROR alpha/NR1F1 Antibody [NBP1-52813] - Western blot analysis of RORa expression in NP tissues isolated from three rats showed positive expression of the protein. Image collected and cropped by CiteAb from ...read more
Western Blot: ROR alpha/NR1F1 Antibody [NBP1-52813] - BMAL1 controls HIF-1 activity without affecting HIF-alpha -TAD functionA. Evaluation of BMAL1 & ROR alpha expression by Western blot in NP cells stably transduced ...read more
Western Blot: ROR alpha/NR1F1 Antibody [NBP1-52813] - BMAL1 & ROR alpha do not bind to HIF-1 alpha in NP cellsA. Immunoprecipitation (IP) of BMAL1 & CLOCK from NP cells cultured under normoxia or hypoxia for 24 h ...read more
Western Blot: ROR alpha/NR1F1 Antibody [NBP1-52813] - Expression analysis of BMAL1 & other related factors in NP cellsA. Immunohistochemical localization of BMAL1 in rat intervertebral disc. Sagittal sections of the ...read more
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
Immunogen
Synthetic peptides corresponding to RORA (RAR-related orphan receptor A) The peptide sequence was selected from the N terminal of RORA (P35398-3). Peptide sequence CGDKSSGIHYGVITCEGCKGFFRRSQQSNATYSCPRQKNCLIDRTSRNRC. The peptide sequence for this immunogen was taken from within the described region.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RORA
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Use in Immunofluorescence (PMID: 21480365), IHC-P reported in scientific literature (PMID:35803929).
Theoretical MW
63 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Publications
Read Publications using NBP1-52813 in the following applications:
The protein encoded by RORA is a member of the NR1 subfamily of nuclear hormone receptors. It can bind as a monomer or as a homodimer to hormone response elements upstream of several genes to enhance the expression of those genes. The specific functions of this protein are not known, but it has been shown to interact with NM23-2, a nucleoside diphosphate kinase involved in organogenesis and differentiation, as well as with NM23-1, the product of a tumor metastasis suppressor candidate gene.The protein encoded by this gene is a member of the NR1 subfamily of nuclear hormone receptors. It can bind as a monomer or as a homodimer to hormone response elements upstream of several genes to enhance the expression of those genes. The specific functions of this protein are not known, but it has been shown to interact with NM23-2, a nucleoside diphosphate kinase involved in organogenesis and differentiation, as well as with NM23-1, the product of a tumor metastasis suppressor candidate gene. Four transcript variants encoding different isoforms have been described for this gene.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Reviews for ROR alpha/NR1F1 Antibody (NBP1-52813) (0)
There are no reviews for ROR alpha/NR1F1 Antibody (NBP1-52813).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
=
÷
Review this Product
Be the first to review our ROR alpha/NR1F1 Antibody and receive a gift card or discount.