![Immunohistochemistry-Paraffin: WIPI1 Antibody [NBP1-88878] - Analysis in human placenta and fallopian tube tissues using NBP1-88878 antibody. Corresponding WIPI1 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/WIPI1-Antibody-Immunohistochemistry-Paraffin-NBP1-88878-img0018.jpg "Immunohistochemistry-Paraffin: WIPI1 Antibody [NBP1-88878] - Analysis in human placenta and fallopian tube tissues using NBP1-88878 antibody. Corresponding WIPI1 RNA-seq data are presented for the same tissues.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, Simple Western, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: HQDRAFATARLNFSGQRNICTLSTIQKLPRLLVASSSGHLYMYNLDPQDGGECVLIKTHSLLGSGTTEENKENDLRPSLPQSYAATVARPSASSASTVPGYSEDGGALRGEVIPEHEFATGPVCLDDENEFPPIILCRG |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | WIPI1 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | WB reported in scientific literature (PMID: 26158518). For IHC-Paraffin, HIER pH 6 retrieval is recommended. WIPI1 antibody validated for Simple Western from a verified customer review. |
||
| Control Peptide |
|
||
| Reviewed Applications |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
| Images | Ratings | Applications | Species | Date | Details | ||||||
|---|---|---|---|---|---|---|---|---|---|---|---|
Enlarge |
reviewed by:
Verified Customer |
Simple Western | Mouse | 03/25/2016 |
Summary
|
Secondary Antibodies |
Isotype Controls |
Research Areas for WIPI1 Antibody (NBP1-88878)Find related products by research area.
|
|
Epigenetic Control of Autophagy By Christina Towers, PhD. In the last 20 years, epigenetic regulation has become front and center for almost all fields of biology and its role in diseases like cancer and neurodegeneration are being heavily studi... Read full blog post. |
|
WIPI1 - An essential regulator of early autophagosome assembly WD repeat domain phosphoinositide-interacting protein 1 (WIPI) is involved in the lysosomal degradation of cytoplasmic components during starvation-induced autophagy. WIPI1 is a seven bladed beta-propeller protein that provides a scaffold for the ... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
5 | |
4 | |
3 | |
2 | |
1 |
| Verified Customer 03/25/2016 |
||
| Application: | Simple Western | |
| Species: | Mouse |
| Gene Symbol | WIPI1 |
![Western Blot: WIPI1 Antibody [NBP1-88878] - Analysis in human cell lines SK-MEL-30 and HeLa using anti-WIPI1 antibody. Corresponding WIPI1 RNA-seq data are presented for the same cell lines. Loading control: anti-COX4I1.](http://images.novusbio.com/fullsize/WIPI1-Antibody-Western-Blot-NBP1-88878-img0017.jpg "Western Blot: WIPI1 Antibody [NBP1-88878] - Analysis in human cell lines SK-MEL-30 and HeLa using anti-WIPI1 antibody. Corresponding WIPI1 RNA-seq data are presented for the same cell lines. Loading control: anti-COX4I1.")
![Immunohistochemistry-Paraffin: WIPI1 Antibody [NBP1-88878] - Staining of human liver shows very weak cytoplasmic positivity in hepatocytes.](http://images.novusbio.com/fullsize/WIPI1-Antibody-Immunohistochemistry-Paraffin-NBP1-88878-img0021.jpg "Immunohistochemistry-Paraffin: WIPI1 Antibody [NBP1-88878] - Staining of human liver shows very weak cytoplasmic positivity in hepatocytes.")
![Western Blot: WIPI1 Antibody [NBP1-88878] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).](http://images.novusbio.com/fullsize/WIPI1-Antibody-Western-Blot-NBP1-88878-img0005.jpg "Western Blot: WIPI1 Antibody [NBP1-88878] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).")
![Immunohistochemistry-Paraffin: WIPI1 Antibody [NBP1-88878] - Staining of human duodenum shows moderate cytoplasmic positivity in glandular and enteroendocrine cells.](http://images.novusbio.com/fullsize/WIPI1-Antibody-Immunohistochemistry-Paraffin-NBP1-88878-img0019.jpg "Immunohistochemistry-Paraffin: WIPI1 Antibody [NBP1-88878] - Staining of human duodenum shows moderate cytoplasmic positivity in glandular and enteroendocrine cells.")
![Immunohistochemistry-Paraffin: WIPI1 Antibody [NBP1-88878] - Staining of human fallopian tube shows very weak cytoplasmic positivity in glandular cells.](http://images.novusbio.com/fullsize/WIPI1-Antibody-Immunohistochemistry-Paraffin-NBP1-88878-img0020.jpg "Immunohistochemistry-Paraffin: WIPI1 Antibody [NBP1-88878] - Staining of human fallopian tube shows very weak cytoplasmic positivity in glandular cells.")
![Immunohistochemistry-Paraffin: WIPI1 Antibody [NBP1-88878] - Staining of human placenta shows strong cytoplasmic positivity in trophoblastic and decidual cells.](http://images.novusbio.com/fullsize/WIPI1-Antibody-Immunohistochemistry-Paraffin-NBP1-88878-img0022.jpg "Immunohistochemistry-Paraffin: WIPI1 Antibody [NBP1-88878] - Staining of human placenta shows strong cytoplasmic positivity in trophoblastic and decidual cells.")
![Immunohistochemistry-Paraffin TOR/mTOR [p Ser2448] Antibody](https://images.novusbio.com/images/TOR-mTOR-[p-Ser2448]-Antibody-Immunohistochemistry-Paraffin-NB600-607-img0005.jpg)
![Western Blot TOR/mTOR [p Ser2448] Antibody](https://images.novusbio.com/images/TOR-mTOR-[p-Ser2448]-Antibody-Western-Blot-NB600-607-img0006.jpg)
![Data TOR/mTOR [p Ser2448] Antibody](https://images.novusbio.com/images/TOR-mTOR-[p-Ser2448]-Antibody-N-A-NB600-607-img0008.jpg)
![Immunohistochemistry GDF-5/BMP-14 Antibody [Unconjugated]](https://images.novusbio.com/images2/GDF-5_AF853_Immunohistochemistry_6908.jpg)
![Western Blot GDF-5/BMP-14 Antibody [Unconjugated]](https://images.novusbio.com/images2/af853_mouse-gdf-5-affinity-purified-polyclonal-ab-western-blot-25102022133916.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")
