Novus Biologicals products are now on bio-techne.com

VRL1 Recombinant Protein Antigen

Images

 
There are currently no images for VRL1 Protein (NBP1-92576PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

VRL1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human TRPV2.

Source: E. coli

Amino Acid Sequence: RGKLDFGSGLPPMESQFQGEDRKFAPQIRVNLNYRKGTGASQPDPNRFDRDRLFNAVSRGVPEDLAGLPEYLSKTSKYLTDS

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
TRPV2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-92576.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

For further blocking peptide related information and a protocol, click here.

Theoretical MW
27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for VRL1 Recombinant Protein Antigen

  • Osm-9-like TRP channel 2
  • OTRPC2
  • transient receptor potential cation channel, subfamily V, member 2
  • TrpV2
  • Vanilloid receptor-like protein 1
  • VRL
  • VRL1
  • VRL-1
  • VRL-1MGC12549
  • VRL1transient receptor potential cation channel subfamily V member 2
  • VRLOTRPC2

Background

Caterina et al has identified a structurally related receptor, VRL-1, that does not respond to capsaicin, acid or moderate heat. Instead, VRL-1 is activated by high temperatures, with a threshold of approximately 52 degrees C. Within sensory ganglia, VRL-1 is most prominently expressed by a subset of medium- to large-diameter neurons, making it a candidate receptor for transducing high-threshold heat responses in this class of cells. VRL-1 transcripts are not restricted to the sensory nervous system, indicating that this channel may be activated by stimuli other than heat. VRL-1 is one of the six members of the vanilloid-like TRP-channel family which is now known as TRPV family. FUNCTION: Calcium-permeable, non-selective cation channel with an outward rectification. Seems to be regulated, at least in part, by growth factors, like IGF1, PDGF and morphogenetic neuropeptide/head activator. May transduce physical stimuli in mast cells. Activated by temperatures higher than 52 degrees Celsius; is not activated by vanilloids and acidic pH. SUBUNIT: Homotetramer (Probable). Interacts with a cAMP-dependent protein kinase type II regulatory subunit (PRKAR2A or PRKAR2B) and ACBD3. Interacts with RGA. SUBCELLULAR LOCATION: Cell membrane; multi-pass membrane protein. Cytoplasm. Translocates from the cytoplasm to the plasma membrane upon ligand stimulation. TISSUE SPECIFICITY: Ubiquitously expressed. Expressed in dorsal root ganglia, trigeminal ganglia, spinal chord (Lissauer's tract, dorsal horn and dorsal columns) (at protein level). PTM: N-glycosylated. PTM: Phosphorylated by PKA. SIMILARITY: Belongs to the transient receptor family. TrpV subfamily. SIMILARITY: Contains 3 ANK repeats.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-71774
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NBP1-88370
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-49671
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-41262
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NBP2-12909
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, MiAr, WB
NBP1-97311
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, WB
NB110-40763
Species: Gp, Hu, Mu, Rt, Ze
Applications: ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, WB
NB100-98844
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, WB
NBP1-48036
Species: Ca, Hu, Pm, Pm
Applications: IHC, IHC-P, WB
NBP2-12906
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, MiAr, WB
NB120-14817
Species: Hu, Rt
Applications: ICC/IF, IHC, S-ELISA, WB
NBP2-32372
Species: Hu, Rt
Applications: IHC, IHC-P
AF1052
Species: Hu
Applications: CyTOF-ready, Flow, IHC, Simple Western, WB
NB110-81601
Species: Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
NB100-93520
Species: Hu
Applications: PEP-ELISA, WB
NBP1-77260
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
MAB4375
Species: Hu, Mu, Rt
Applications: IHC
AF2747
Species: Mu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), IHC, IP, WB
NB100-98864
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBP1-92576PEP
Species: Hu
Applications: AC

Publications for VRL1 Protein (NBP1-92576PEP) (0)

There are no publications for VRL1 Protein (NBP1-92576PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for VRL1 Protein (NBP1-92576PEP) (0)

There are no reviews for VRL1 Protein (NBP1-92576PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for VRL1 Protein (NBP1-92576PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional VRL1 Products

Research Areas for VRL1 Protein (NBP1-92576PEP)

Find related products by research area.

Blogs on VRL1

There are no specific blogs for VRL1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

VRL1 Antibody
NBP1-32096

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our VRL1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol TRPV2