Home » VPS11 » VPS11 Proteins » Recombinant Human VPS11 GST (N-Term) Protein

Recombinant Human VPS11 GST (N-Term) Protein

 Submit a Review

Images

 
(
Enlarge)
12.5% SDS-PAGE Stained with Coomassie Blue.
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, MA, AP

Order Details

Novus Biologicals offers 100% Guarantee

Recombinant Human VPS11 GST (N-Term) Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-331 of Human VPS11

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MSEVQPDSPQGIYDTLLELRLQNWAHEKDPQVKEKLHAEAISLLKSGRFCDVFDKALVLCQMHDFQDGVLYLYEQGKLFQQIMHYHMQHEQYRQVISVCERHGEQDPSLWEQALSYFARKEEDCKEYVAAVLKHIENKNLMPPLLVVQTLAHNSTATLSVIRDYLVQKLQKQSQQIAQDELRVRRYREETTRIRQEIQELKASPKIFQKTKCSICNSALELPSVHFLCGHSFHQHCFESYSESDADCPTCLPENRKVMDMIRAQEQKRDLHDQFQHQLRCSNDSFSVIADYFGRGVFNKLTLLTDPPTARLTSSLEAGLQRDLLMHSRRGT
Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Recombinant Protein
Gene
VPS11
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
Theoretical MW
65 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human VPS11 GST (N-Term) Protein

  • hVPS11
  • PEP5
  • RING finger protein 108
  • RNF108END1
  • vacuolar protein sorting 11 (yeast homolog)
  • vacuolar protein sorting 11 homolog (S. cerevisiae)
  • vacuolar protein sorting protein 11
  • vacuolar protein sorting-associated protein 11 homolog

Background

Vesicle mediated protein sorting plays an important role in segregation of intracellular molecules into distinct organelles. Genetic studies in yeast have identified more than 40 vacuolar protein sorting (VPS) genes involved in vesicle transport to vacuoles. This gene encodes the human homolog of yeast class C Vps11 protein. The mammalian class C Vps proteins are predominantly associated with late endosomes/lysosomes, and like their yeast counterparts, may mediate vesicle trafficking steps in the endosome/lysosome pathway. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

VPS18 Antibody
NBP1-82906
Western Blot VPS18 Antibody
Immunohistochemistry-Paraffin VPS18 Antibody
Immunohistochemistry-Paraffin VPS18 Antibody
Species: Hu
Applications: IHC, IHC-P, WB
VPS16 Antibody
(2F10)
H00064601-M05
Sandwich ELISA VPS16 Antibody (2F10)
Immunocytochemistry/ Immunofluorescence VPS16 Antibody (2F10)
Immunocytochemistry/ Immunofluorescence VPS16 Antibody (2F10)
Species: Hu
Applications: ELISA, ICC/IF, S-ELISA, WB
VPS39 Antibody -
BSA Free
NBP1-76535
Immunocytochemistry/ Immunofluorescence VPS39 Antibody - BSA Free
Immunohistochemistry VPS39 Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence VPS39 Antibody - BSA Free
(1 Review)
(2 Publications)
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
TMUB1 Antibody
NBP1-86731
Western Blot TMUB1 Antibody
Immunocytochemistry/ Immunofluorescence TMUB1 Antibody
Immunohistochemistry-Paraffin TMUB1 Antibody
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
PP14/Glycodelin
Antibody
NBP1-89781
Immunohistochemistry-Paraffin PP14/Glycodelin Antibody
Immunohistochemistry-Paraffin PP14/Glycodelin Antibody
Western Blot PP14/Glycodelin Antibody
Species: Hu
Applications: IHC, IHC-P, WB
Prolyl
Oligopeptidase/PREP A
NBP2-33950
Immunocytochemistry/ Immunofluorescence Prolyl Oligopeptidase/PREP Antibody
Immunohistochemistry-Paraffin Prolyl Oligopeptidase/PREP Antibody
Immunohistochemistry-Paraffin Prolyl Oligopeptidase/PREP Antibody
(3 Publications)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Lyp/PTPN22
Antibody [Unconjugate
AF3428
Western Blot Lyp/PTPN22 Antibody [Unconjugated]
Simple Western Lyp/PTPN22 Antibody [Unconjugated]
Immunocytochemistry Lyp/PTPN22 Antibody [Unconjugated]
(9 Publications)
Species: Hu
Applications: ICC, Simple Western, WB
Alkaline
Phosphatase/ALPL Anti ...
AF2910
Immunohistochemistry Alkaline Phosphatase/ALPL Antibody [Unconjugated]
Western Blot Alkaline Phosphatase/ALPL Antibody [Unconjugated]
Flow Cytometry Alkaline Phosphatase/ALPL Antibody [Unconjugated]
(44 Publications)
Species: Mu
Applications: CyTOF-ready, Flow, ICC, IHC, IP, WB
VPS41 Antibody
NB100-2425
Immunohistochemistry-Paraffin VPS41 Antibody
Immunohistochemistry-Paraffin VPS41 Antibody
Immunohistochemistry-Paraffin VPS41 Antibody
(2 Publications)
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA, WB
VPS8 Antibody (2C8)
H00023355-M01
Sandwich ELISA VPS8 Antibody (2C8)
Immunocytochemistry/ Immunofluorescence VPS8 Antibody (2C8)
Species: Hu
Applications: ELISA, ICC/IF, S-ELISA, WB
SNAP25 Antibody
(OTI4G5)
NBP2-00795
Flow Cytometry SNAP25 Antibody (OTI4G5)
Western Blot SNAP25 Antibody (OTI4G5)
Immunohistochemistry-Paraffin SNAP25 Antibody (OTI4G5)
(1 Publication)
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
EEA1 Antibody
(6D4.1D4) - BSA Free
NBP2-36568
Flow (Intracellular) EEA1 Antibody (6D4.1D4) - BSA Free
Immunohistochemistry-Paraffin EEA1 Antibody (6D4.1D4) - BSA Free
Immunohistochemistry-Paraffin EEA1 Antibody (6D4.1D4) - BSA Free
(3 Publications)
Species: Hu, Mu
Applications: Flow-IC, ICC/IF, IHC, IHC-P, WB
Endothelin-1 [HRP]
QET00B
N/A Endothelin-1 [HRP]
N/A Endothelin-1 [HRP]
(48 Publications)
Species: Hu
Applications: ELISA
RAB6A Antibody
NBP1-33110
Immunocytochemistry/ Immunofluorescence RAB6A Antibody
Western Blot RAB6A Antibody
Western Blot RAB6A Antibody
(1 Publication)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KO, WB
Neuropilin-1
Antibody [Unconjugate
AF566
Immunohistochemistry Neuropilin-1 Antibody [Unconjugated]
Immunohistochemistry Neuropilin-1 Antibody [Unconjugated]
Western Blot Neuropilin-1 Antibody [Unconjugated]
(10 Reviews)
(109 Publications)
Species: Mu, Rt
Applications: Block, CyTOF-ready, Flow, IHC, WB
Recombinant Human
VPS11 GST (N-Term) Pr ...
H00055823-P01
Recombinant Human VPS11 GST (N-Term) Protein
Species: Hu
Applications: WB, ELISA, MA, AP

Publications for VPS11 Recombinant Protein (H00055823-P01) (0)

There are no publications for VPS11 Recombinant Protein (H00055823-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for VPS11 Recombinant Protein (H00055823-P01) (0)

There are no reviews for VPS11 Recombinant Protein (H00055823-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for VPS11 Recombinant Protein (H00055823-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional VPS11 Products

Research Areas for VPS11 Recombinant Protein (H00055823-P01)

Find related products by research area.

Blogs on VPS11

There are no specific blogs for VPS11, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human VPS11 GST (N-Term) Protein and receive a gift card or discount.


Bioinformatics

Gene Symbol VPS11