![Western Blot: Vang-like Protein 2/VANGL2 [p Ser84, p Ser79, p Ser82] Antibody (5N5B3) [NBP3-16947] - Western blot analysis of extracts of HeLa cells, using Vang-like Protein 2/VANGL2 antibody (NBP3-16947) at 1:1000 dilution.HeLa cells were treated by wnt(100ng/ml) for 30 minutes. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 60s.](http://images.novusbio.com/fullsize/Vang-like-Protein-2-VANGL2-p-Ser84-p-Ser79-p-Ser82-Antibody-5N5B3-Western-Blot-NBP3-16947-img0001.jpg "Western Blot: Vang-like Protein 2/VANGL2 [p Ser84, p Ser79, p Ser82] Antibody (5N5B3) [NBP3-16947] - Western blot analysis of extracts of HeLa cells, using Vang-like Protein 2/VANGL2 antibody (NBP3-16947) at 1:1000 dilution.HeLa cells were treated by wnt(100ng/ml) for 30 minutes. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 60s.")
| Reactivity | Hu, RtSpecies Glossary |
| Applications | WB |
| Clone | 6O6T6 |
| Clonality | Monoclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Additional Information | Recombinant Monoclonal Antibody |
| Immunogen | A phospho specific peptide corresponding to residues surrounding S79/S82/S84 of human Vang-like Protein 2/VANGL2. RDDNWGETTTVVTGTSEHSISHDDLTRIAKDMEDSVPLDC |
| Modification | p Ser79, p Ser82, p Ser84 |
| Isotype | IgG |
| Clonality | Monoclonal |
| Host | Rabbit |
| Gene | VANGL2 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Storage | Store at -20C. Avoid freeze-thaw cycles. |
| Buffer | PBS, 0.05% BSA, 50% glycerol, pH7.3 |
| Preservative | 0.05% Proclin 300 |
| Purity | Affinity purified |
![Western Blot beta-Catenin Antibody [Unconjugated]](https://images.novusbio.com/images2/beta-Catenin_AF1329_Western_Blot_5100.jpg)
![Chromatin Immunoprecipitation (ChIP) beta-Catenin Antibody [Unconjugated]](https://images.novusbio.com/images2/beta-Catenin_AF1329_Chromatin_Immunoprecipitation_11251.jpg)
![Simple Western beta-Catenin Antibody [Unconjugated]](https://images.novusbio.com/images2/betaCatenin_AF1329_Simple_Western_17134.jpg)
![Vang-like Protein 2/VANGL2 [p Ser84, p Ser79, p Ser82] Antibody (6O6T6)](/sites/all/modules/enterprise-tech/et_datasheets/images/novus_guarantee.png "Vang-like Protein 2/VANGL2 [p Ser84, p Ser79, p Ser82] Antibody (6O6T6)")
Secondary Antibodies |
Isotype Controls |
Research Areas for Vang-like Protein 2/VANGL2 Antibody (NBP3-16947)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | VANGL2 |
![Western Blot BMP-1/PCP Antibody [Unconjugated]](https://images.novusbio.com/images2/BMP1_AF1927_Western_Blot_21018.jpg)
![Western Blot BMP-1/PCP Antibody [Unconjugated]](https://images.novusbio.com/images2/BMP1_AF1927_Western_Blot_21019.jpg)
![Bioactivity Wnt-5a [Unconjugated]](https://images.novusbio.com/images/protein/645-wn_recombinant-human-mouse-wnt-5a-protein-bioactivity-1612202094911.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")