![Immunocytochemistry/Immunofluorescence: USP11 Antibody [NBP1-80640] - Immunofluorescent staining of human cell line RH-30 shows localization to nucleoplasm & cytosol.](http://images.novusbio.com/fullsize/USP11-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-80640-img0005.jpg "Immunocytochemistry/Immunofluorescence: USP11 Antibody [NBP1-80640] - Immunofluorescent staining of human cell line RH-30 shows localization to nucleoplasm & cytosol.")
| Reactivity | HuSpecies Glossary |
| Applications | ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: ESGRERPLRAGESWFLVEKHWYKQWEAYVQGGDQDSSTFPGCINNATLFQDEINWRLKEGLVEGEDYVLLPAAAWHYLVSWYGLEHGQPPIERKVIELPNIQKVEVYPVELLLVRHNDLGKSHTVQFS |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | USP11 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for USP11 Antibody (NBP1-80640)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunohistochemistry-Paraffin: USP11 Antibody [NBP1-80640] - Staining of human testis shows strong nuclear positivity in a subset of cells in seminiferous ducts.](http://images.novusbio.com/fullsize/USP11-Antibody-Immunohistochemistry-Paraffin-NBP1-80640-img0021.jpg "Immunohistochemistry-Paraffin: USP11 Antibody [NBP1-80640] - Staining of human testis shows strong nuclear positivity in a subset of cells in seminiferous ducts.")
![Immunohistochemistry-Paraffin: USP11 Antibody [NBP1-80640] - Staining of human cerebellum, cerebral cortex, skeletal muscle and testis using Anti-USP11 antibody NBP1-80640 (A) shows similar protein distribution across tissues to independent antibody NBP1-80639 (B).](http://images.novusbio.com/fullsize/USP11-Antibody-Immunohistochemistry-Paraffin-NBP1-80640-img0012.jpg "Immunohistochemistry-Paraffin: USP11 Antibody [NBP1-80640] - Staining of human cerebellum, cerebral cortex, skeletal muscle and testis using Anti-USP11 antibody NBP1-80640 (A) shows similar protein distribution across tissues to independent antibody NBP1-80639 (B).")
![Immunohistochemistry-Paraffin: USP11 Antibody [NBP1-80640] - Analysis in human cerebral cortex and skeletal muscle tissues. Corresponding USP11 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/USP11-Antibody-Immunohistochemistry-Paraffin-NBP1-80640-img0013.jpg "Immunohistochemistry-Paraffin: USP11 Antibody [NBP1-80640] - Analysis in human cerebral cortex and skeletal muscle tissues. Corresponding USP11 RNA-seq data are presented for the same tissues.")
![Immunohistochemistry-Paraffin: USP11 Antibody [NBP1-80640] - Staining of human kidney.](http://images.novusbio.com/fullsize/USP11-Antibody-Immunohistochemistry-Paraffin-NBP1-80640-img0014.jpg "Immunohistochemistry-Paraffin: USP11 Antibody [NBP1-80640] - Staining of human kidney.")
![Immunohistochemistry-Paraffin: USP11 Antibody [NBP1-80640] - Staining of human cerebral cortex.](http://images.novusbio.com/fullsize/USP11-Antibody-Immunohistochemistry-Paraffin-NBP1-80640-img0015.jpg "Immunohistochemistry-Paraffin: USP11 Antibody [NBP1-80640] - Staining of human cerebral cortex.")
![Immunohistochemistry-Paraffin: USP11 Antibody [NBP1-80640] - Staining of human skeletal muscle shows no positivity in myocytes as expected.](http://images.novusbio.com/fullsize/USP11-Antibody-Immunohistochemistry-Paraffin-NBP1-80640-img0016.jpg "Immunohistochemistry-Paraffin: USP11 Antibody [NBP1-80640] - Staining of human skeletal muscle shows no positivity in myocytes as expected.")
![Immunohistochemistry-Paraffin: USP11 Antibody [NBP1-80640] - Staining of human cerebellum shows weak nuclear positivity in Purkinje cells.](http://images.novusbio.com/fullsize/USP11-Antibody-Immunohistochemistry-Paraffin-NBP1-80640-img0017.jpg "Immunohistochemistry-Paraffin: USP11 Antibody [NBP1-80640] - Staining of human cerebellum shows weak nuclear positivity in Purkinje cells.")
![Immunohistochemistry-Paraffin: USP11 Antibody [NBP1-80640] - Staining of human cerebral cortex shows weak to moderate nuclear positivity in neurons.](http://images.novusbio.com/fullsize/USP11-Antibody-Immunohistochemistry-Paraffin-NBP1-80640-img0020.jpg "Immunohistochemistry-Paraffin: USP11 Antibody [NBP1-80640] - Staining of human cerebral cortex shows weak to moderate nuclear positivity in neurons.")
![SDS-PAGE TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNF-alpha_210-TA_256.jpg)
![Bioactivity TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNFalpha_210TA_1658.jpg)
![SEC-MALS TNF-alpha [Unconjugated]](https://images.novusbio.com/images/210-ta_recombinant-human-tnf-alpha-protein-sec-mals-35202312244..jpg)
![N/A IL-6 [HRP]](https://images.novusbio.com/images2/DATA_IL6_M6000_ELISA_936.jpg)
![N/A IL-6 [HRP]](https://images.novusbio.com/images2/IL-6_M6000_ELISA_415.jpg)
![N/A IL-6 [HRP]](https://images.novusbio.com/images/m6000b_mouse-il-6-quantikine-elisa-kit-44202415433118.jpg)
![Western Blot BRCA2 Antibody (234403) [Unconjugated]](https://images.novusbio.com/images2/BRCA2_MAB2476_Western_Blot_6033.jpg)
![Immunohistochemistry BRCA2 Antibody (234403) [Unconjugated]](https://images.novusbio.com/images2/mab2476_human-brca2-mab-clone-234403-immunohistochemistry-10520211657.jpg)
![Western Blot BRCA2 Antibody (234403) [Unconjugated]](https://images.novusbio.com/images/mab2476_human-brca2-mab-clone-234403-2282024172111.jpg)
![Western Blot TGF-beta RI/ALK-5 Antibody [Unconjugated]](https://images.novusbio.com/images2/TGFbeta_RI_AF3025_Western_Blot_17081.jpg)
![Immunocytochemistry TGF-beta RI/ALK-5 Antibody [Unconjugated]](https://images.novusbio.com/images2/TGF-beta_RI_AF3025_Immunocytochemistry_9948.jpg)
![Western Blot TGF-beta RI/ALK-5 Antibody [Unconjugated]](https://images.novusbio.com/images/af3025_human-tgf-beta-ri-alk-5-affinity-purified-polyclonal-ab-41202412402510.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")