Home » Ubiquitin C » ubiquitin C Proteins » Ubiquitin C Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

Ubiquitin C Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for Ubiquitin C Recombinant Protein Antigen (NBP2-54692PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

Ubiquitin C Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Ubiquitin C

Source: E. coli

Amino Acid Sequence: MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQ

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
UBC
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10-100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-54692.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
22 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Ubiquitin C Recombinant Protein Antigen

  • HMG20
  • PolyUbiquitin
  • polyubiquitin-B
  • Polyubiquitin-C
  • UBC
  • Ubiquitin-40S ribosomal protein S27a
  • ubiquitin-60S ribosomal protein L40

Background

Ubiquitin is a small protein that is composed of 76 amino acids and its sequence is highly conserved throughout evolution from invertebrates to mammals. In the cytoplasm, ubiquitin is involved in ATP-dependent nonlysomal proteolysis of various proteins. In the nucleus, ubiquitin is conjugated to histone2A and may play a role in regulation of chromatin structure and/or regulation of transcriptional activity.Ubiquitin(76amino acid) was overexpressed in E.coli and purified by using conventional chromatography techniques.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

GAPDH Antibody
(1D4)
NB300-221
Western Blot GAPDH Antibody (1D4)
Immunocytochemistry/ Immunofluorescence GAPDH Antibody (1D4)
Immunocytochemistry/ Immunofluorescence GAPDH Antibody (1D4)
(19 Reviews)
(431 Publications)
Species: Av, Bv, Ca, Ch, ChHa, Dr, Eq, Fe, Ha, Hu, Mu, Ma-Op, Po, Pm, Rb, Rt, Sh, Ze
Applications: ChIP, ICC/IF, IHC, IHC-Fr, IP, KD, Simple Western, Single-Cell Western, WB
HMBS Antibody
NBP2-33600
Immunohistochemistry-Paraffin HMBS Antibody
Immunohistochemistry-Paraffin HMBS Antibody
Immunohistochemistry-Paraffin HMBS Antibody
(2 Publications)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Actin Gamma 1
Antibody
NB600-533
Western Blot Actin Gamma 1 Antibody
Western Blot Actin Gamma 1 Antibody
Western Blot Actin Gamma 1 Antibody
(6 Publications)
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC, IP, Simple Western, WB
HPRT Antibody
NBP1-33527
Western Blot HPRT Antibody
Western Blot HPRT Antibody
Immunohistochemistry-Paraffin HPRT Antibody
(4 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KO, WB
DBT Antibody
NBP1-89522
Immunocytochemistry/ Immunofluorescence DBT Antibody
Immunohistochemistry-Paraffin DBT Antibody
Immunohistochemistry-Paraffin DBT Antibody
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
beta
2-Microglobulin Antib ...
NB500-317
Western Blot beta 2-Microglobulin Antibody (B2M-01) - BSA Free
Flow Cytometry beta 2-Microglobulin Antibody (B2M-01) - BSA Free
ELISA beta 2-Microglobulin Antibody (B2M-01) - BSA Free
(1 Review)
(3 Publications)
Species: Bv(-), Ca(-), Ch(-), Hu, Mu(-), Rb(-)
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, IP, RIA, WB
beta-Actin
Antibody (AC-15)
NB600-501
Western Blot beta-Actin Antibody (AC-15)
Simple Western beta-Actin Antibody (AC-15)
Western Blot beta-Actin Antibody (AC-15)
(27 Reviews)
(595 Publications)
Species: Bv, Ca, Ch, Dr(-), Fe, Fi, Gp, Ha, Hu, Le, Ma, Mu, Po, Pm, Rb, Rt, Sh, Sq, Tr, Ze
Applications: ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD, KO, Simple Western, WB
UEV2 Antibody
NB100-56360
Western Blot UEV2 Antibody
Species: Hu
Applications: WB
Recombinant Human
TATA binding protein ...
H00006908-Q01
SDS-PAGE Recombinant Human TATA binding protein TBP GST (N-Term) Protein
(5 Publications)
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
14-3-3 zeta
Antibody (818515) [Un ...
MAB2669
Simple Western 14-3-3 zeta Antibody (818515) [Unconjugated]
Western Blot 14-3-3 zeta Antibody (818515) [Unconjugated]
Immunohistochemistry 14-3-3 zeta Antibody (818515) [Unconjugated]
(2 Reviews)
(1 Publication)
Species: Hu
Applications: IHC, Simple Western, WB
UBE2N/Ubc13
Antibody - BSA Free
NBP1-76593
Immunocytochemistry/ Immunofluorescence UBE2N/Ubc13 Antibody - BSA Free
Immunohistochemistry UBE2N/Ubc13 Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence UBE2N/Ubc13 Antibody - BSA Free
(2 Publications)
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
SDHA Antibody
(GT20710)
NBP3-13522
Western Blot SDHA Antibody (GT20710)
Western Blot SDHA Antibody (GT20710)
Immunocytochemistry/ Immunofluorescence SDHA Antibody (GT20710)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
UBE2K/E2-25K
Antibody (701316)
MAB6609
Western Blot UBE2K/E2-25K Antibody (701316)
Immunohistochemistry UBE2K/E2-25K Antibody (701316)
(1 Publication)
Species: Hu, Mu
Applications: IHC, WB

Butyrylcholinesterase/ ...
AF9024
Western Blot Butyrylcholinesterase/BCHE Antibody [Unconjugated]
Immunohistochemistry Butyrylcholinesterase/BCHE Antibody [Unconjugated]
(2 Publications)
Species: Mu, Rt
Applications: IHC, WB
MASA Antibody
NBP2-13961
Immunohistochemistry-Paraffin MASA Antibody
Immunohistochemistry-Paraffin MASA Antibody
Immunohistochemistry-Paraffin MASA Antibody
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
p21/CIP1/CDKN1A
Antibody (WA-1)
NBP2-29463
Immunohistochemistry-Paraffin p21/CIP1/CDKN1A Antibody (WA-1)
(24 Publications)
Species: Pm, Hu, Pm, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Elastase Antibody
(CELA3B/1257) - Azide ...
NBP2-54301
Immunohistochemistry-Paraffin Elastase Antibody (CELA3B/1257) - Azide and BSA Free
Immunohistochemistry-Paraffin Elastase Antibody (CELA3B/1257) - Azide and BSA Free
Immunohistochemistry-Paraffin Elastase Antibody (CELA3B/1257) - Azide and BSA Free
Species: Hu, Mu, Rt
Applications: CyTOF-ready, ELISA, IHC, IHC-P, WB
beta-Actin
Antibody (AC-15)
NB600-501
Western Blot beta-Actin Antibody (AC-15)
Simple Western beta-Actin Antibody (AC-15)
Western Blot beta-Actin Antibody (AC-15)
(27 Reviews)
(595 Publications)
Species: Bv, Ca, Ch, Dr(-), Fe, Fi, Gp, Ha, Hu, Le, Ma, Mu, Po, Pm, Rb, Rt, Sh, Sq, Tr, Ze
Applications: ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD, KO, Simple Western, WB
EIF3B Antibody
NB100-93302
Immunohistochemistry-Paraffin EIF3B Antibody
Western Blot EIF3B Antibody
Immunoprecipitation EIF3B Antibody
(2 Publications)
Species: Hu
Applications: ICC/IF, IHC, IHC-P, IP, WB
Ubiquitin C
Recombinant Protein A
NBP2-54692PEP
Ubiquitin C Recombinant Protein Antigen
Species: Hu
Applications: AC

Publications for Ubiquitin C Recombinant Protein Antigen (NBP2-54692PEP) (0)

There are no publications for Ubiquitin C Recombinant Protein Antigen (NBP2-54692PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Ubiquitin C Recombinant Protein Antigen (NBP2-54692PEP) (0)

There are no reviews for Ubiquitin C Recombinant Protein Antigen (NBP2-54692PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Ubiquitin C Recombinant Protein Antigen (NBP2-54692PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Ubiquitin C Products

Research Areas for Ubiquitin C Recombinant Protein Antigen (NBP2-54692PEP)

Find related products by research area.

Blogs on Ubiquitin C

There are no specific blogs for Ubiquitin C, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Western Blot: beta-Actin Antibody (AC-15) [NB600-501] - HEK293T cells transfected with Niaph virus Matrix Protein, expression 24h later. This image was submitted via customer review.
beta-Actin Antibody (AC-15)
NB600-501
Analysis of cell line lysates probed with mouse mAb to GAPDH (theoretical molecular weight: 36 kDa), NB300-221, dilution 1:2,000: [1] protein standard, [2] HEK293, [3] HeLa, [4] SH-SY5Y, [5] COS1, [6] NIH-3T3, and [7] C6 cells. The GAPDH antibody reveals a single band at ~37 kDa in all cell lines. GAPDH is a house keeping protein, the level of which is relatively unaffected by most experimental manipulations, and, as a result, this antibody has been widely used as a western blotting loading control.
GAPDH Antibody (1D4)
NB300-221

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Ubiquitin C Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol UBC