Home » U11/U12-35K » U11/U12-35K Proteins » U11/U12-35K Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

U11/U12-35K Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for U11/U12-35K Recombinant Protein Antigen (NBP2-56203PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

U11/U12-35K Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human SNRNP35.

Source: E. coli

Amino Acid Sequence: LGGGLGGKKESGQLRFGGRDRPFRKPINLPVVKNDLYREGKRERRERS

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
SNRNP35
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10-100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-56203.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
23 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for U11/U12-35K Recombinant Protein Antigen

  • HM1
  • HM-1
  • MGC138160
  • Protein HM-1
  • small nuclear ribonucleoprotein 35kDa (U11/U12)
  • U1 snRNP-binding protein homolog
  • U11/U12 small nuclear ribonucleoprotein 35 kDa protein
  • U11/U12 snRNP 35 kDa protein
  • U11/U12 snRNP 35K
  • U11/U12-35K
  • U1-snRNP binding protein homolog
  • U1SNRNPBPU1 snRNP binding protein homolog

Background

The protein encoded by the U1SNRNPBP gene is a homolog of U1-snRNP binding protein. The N-terminal half contains a RNA recognition motif and the C-terminal is rich in Arg/Asp and Arg/Glu dipeptides; a characteristic of a variety of splicing factors. This protein is a component of the U11/U12 small nuclear ribonucleoproteins (snRNP) that form part of the U12-type spliceosome. This gene is differentially expressed in a variety of human tissues. Alternative splicing results in multiple transcript variants encoding distinct proteins.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

BST2 Antibody
(120G8.04)
DDX0390P-100
Immunocytochemistry/ Immunofluorescence BST2 Antibody (120G8.04)
Immunohistochemistry BST2 Antibody (120G8.04)
Flow Cytometry BST2 Antibody (120G8.04)
(64 Publications)
Species: Hu, Mu
Applications: B/N, Flow, ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, IP, In vivo
NOD2 Antibody
(2D9) - BSA Free
NB100-524
Flow Cytometry NOD2 Antibody (2D9) - BSA Free
Flow Cytometry NOD2 Antibody (2D9) - BSA Free
Immunohistochemistry-Frozen NOD2 Antibody (2D9) - BSA Free
(1 Review)
(26 Publications)
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
HLA DQ/DR/DP
Antibody (HLA-Pan/296 ...
NBP2-79843
Protein Array HLA DQ/DR/DP Antibody (HLA-Pan/2967R) - Azide and BSA Free
Immunocytochemistry/ Immunofluorescence HLA DQ/DR/DP Antibody (HLA-Pan/2967R) - Azide and BSA Free
Western Blot HLA DQ/DR/DP Antibody (HLA-Pan/2967R) - Azide and BSA Free
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, PA, WB
CTLA-4
[Unconjugated]
7268-CT
Bioactivity CTLA-4 [Unconjugated]
(3 Publications)
Species: Hu
Applications: BA
Muscarinic
Acetylcholine Recepto ...
NBP1-87466
Immunohistochemistry-Paraffin Muscarinic Acetylcholine Receptor M1/CHRM1 Antibody
Immunohistochemistry-Paraffin Muscarinic Acetylcholine Receptor M1/CHRM1 Antibody
Immunocytochemistry/ Immunofluorescence Muscarinic Acetylcholine Receptor M1/CHRM1 Antibody
(1 Review)
(5 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, WB
Muscarinic
Acetylcholine Recepto ...
NLS1331
Immunohistochemistry-Paraffin Muscarinic Acetylcholine Receptor M2/CHRM2 Antibody - BSA Free
Immunohistochemistry-Paraffin Muscarinic Acetylcholine Receptor M2/CHRM2 Antibody - BSA Free
Immunohistochemistry-Paraffin Muscarinic Acetylcholine Receptor M2/CHRM2 Antibody - BSA Free
(2 Publications)
Species: Bt, Bv, Ca, Gp, Ha, Hu, Pm, Mu, Po, Pm, Rb, Rt, Sh
Applications: IHC, IHC-P
Glucose 6
phosphate isomerase A ...
NBP2-02541
Western Blot Glucose 6 phosphate isomerase Antibody (OTI2D2)
Immunohistochemistry-Paraffin Glucose 6 phosphate isomerase Antibody (OTI2D2)
Immunohistochemistry-Paraffin Glucose 6 phosphate isomerase Antibody (OTI2D2)
(1 Publication)
Species: Hu, Pm, Mu, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, WB
CD4 Antibody - BSA
Free
NBP1-19371
Immunohistochemistry-Frozen CD4 Antibody - BSA Free
Immunohistochemistry-Paraffin CD4 Antibody - BSA Free
Flow Cytometry CD4 Antibody - BSA Free
(9 Reviews)
(50 Publications)
Species: Ca, Hu, Mu, Po, Rb, Rt
Applications: Dual ISH-IHC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
IL-2 [Unconjugated]
202-IL
Bioactivity IL-2 [Unconjugated]
(4 Reviews)
(377 Publications)
Species: Hu
Applications: BA
TRAILR2/TNFRSF10B
Antibody
NB100-56618
Immunohistochemistry-Paraffin TRAILR2/TNFRSF10B Antibody
Immunohistochemistry TRAILR2/TNFRSF10B Antibody
Western Blot TRAILR2/TNFRSF10B Antibody
(1 Review)
(43 Publications)
Species: Hu, Mu
Applications: Flow-CS, Flow, ICC/IF, IHC, IHC-P, WB
MxA/Mx1 Antibody
NBP1-32905
Immunohistochemistry-Paraffin MxA/Mx1 Antibody
Western Blot MxA/Mx1 Antibody
Western Blot MxA/Mx1 Antibody
(1 Review)
(1 Publication)
Species: Bv, Hu, Pm, Rb
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
GNPDA1 Antibody
NBP2-24653
Western Blot GNPDA1 Antibody
Immunohistochemistry-Paraffin GNPDA1 Antibody
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
IFN-gamma
[Unconjugated]
285-IF
Bioactivity IFN-gamma [Unconjugated]
SDS-PAGE IFN-gamma [Unconjugated]
SEC-MALS IFN-gamma [Unconjugated]
(2 Reviews)
(451 Publications)
Species: Hu
Applications: BA
CCL19/MIP-3 beta
440-M3
CCL19/MIP-3 beta
(39 Publications)
Species: Mu
Applications: BA, BA
AKR1A1 Antibody
(OTI6E3)
NBP2-02164
Flow Cytometry AKR1A1 Antibody (OTI6E3)
Flow Cytometry AKR1A1 Antibody (OTI6E3)
Flow Cytometry AKR1A1 Antibody (OTI6E3)
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
HPRT Antibody
NBP1-33527
Western Blot HPRT Antibody
Western Blot HPRT Antibody
Immunohistochemistry-Paraffin HPRT Antibody
(3 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KO, WB
U11/U12-35K
Recombinant Protein A
NBP2-56203PEP
U11/U12-35K Recombinant Protein Antigen
Species: Hu
Applications: AC

Publications for U11/U12-35K Recombinant Protein Antigen (NBP2-56203PEP) (0)

There are no publications for U11/U12-35K Recombinant Protein Antigen (NBP2-56203PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for U11/U12-35K Recombinant Protein Antigen (NBP2-56203PEP) (0)

There are no reviews for U11/U12-35K Recombinant Protein Antigen (NBP2-56203PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for U11/U12-35K Recombinant Protein Antigen (NBP2-56203PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional U11/U12-35K Products

Blogs on U11/U12-35K

There are no specific blogs for U11/U12-35K, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Recombinant Human IFN-gamma (Catalog # 285‑IF) demonstrates anti-viral activity in HeLa human cervical epithelial carcinoma cells infected with encephalomyocarditis (EMC) virus. The activity is over 2-fold greater than the top competitor's IFN-gamma .
IFN-gamma [Unconjugated]
285-IF-100
As an alternative, please consider our next generation Recombinant Human IL-2 (BT-002). It has equivalent bioactivity to Recombinant Human IL-2 (Catalog # 202-IL). It combines R&D Systems quality with scalability that allows for a solid supply chain. Both Recombinant Human IL-2 proteins are measured in a cell proliferation assay using CTLL 2 mouse cytotoxic T cells.
IL-2 [Unconjugated]
202-IL-010

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our U11/U12-35K Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol SNRNP35