![Immunohistochemistry-Paraffin: Troponin C (cardiac) Antibody [NBP2-55151] - Staining in human heart muscle and prostate tissues using anti-TNNC1 antibody. Corresponding TNNC1 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/Troponin-C-cardiac-Antibody-Immunohistochemistry-Paraffin-NBP2-55151-img0004.jpg "Immunohistochemistry-Paraffin: Troponin C (cardiac) Antibody [NBP2-55151] - Staining in human heart muscle and prostate tissues using anti-TNNC1 antibody. Corresponding TNNC1 RNA-seq data are presented for the same tissues.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: MDDIYKAAVEQLTEEQKNEFKAAFDIFVLGAEDGCISTKELGKVM |
| Predicted Species | Mouse (100%), Rat (100%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | TNNC1 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. IHC-P Retrieval method: HIER pH6. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for Troponin C (cardiac) Antibody (NBP2-55151)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | TNNC1 |
![Immunohistochemistry-Paraffin: Troponin C (cardiac) Antibody [NBP2-55151] - Staining of human heart muscle, liver, prostate and skeletal muscle using Anti-TNNC1 antibody NBP2-55151 (A) shows similar protein distribution across tissues to independent antibody NBP2-37958 (B).](http://images.novusbio.com/fullsize/Troponin-C-cardiac-Antibody-Immunohistochemistry-Paraffin-NBP2-55151-img0006.jpg "Immunohistochemistry-Paraffin: Troponin C (cardiac) Antibody [NBP2-55151] - Staining of human heart muscle, liver, prostate and skeletal muscle using Anti-TNNC1 antibody NBP2-55151 (A) shows similar protein distribution across tissues to independent antibody NBP2-37958 (B).")
![Immunocytochemistry/Immunofluorescence: Troponin C (cardiac) Antibody [NBP2-55151] - Staining of human cell line HeLa shows localization to nucleoplasm, mitochondria & actin filaments. Antibody staining is shown in green.](http://images.novusbio.com/fullsize/Troponin-C-cardiac-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-55151-img0001.jpg "Immunocytochemistry/Immunofluorescence: Troponin C (cardiac) Antibody [NBP2-55151] - Staining of human cell line HeLa shows localization to nucleoplasm, mitochondria & actin filaments. Antibody staining is shown in green.")
![Immunohistochemistry-Paraffin: Troponin C (cardiac) Antibody [NBP2-55151] - Staining of human liver using Anti-TNNC1 antibody.](http://images.novusbio.com/fullsize/Troponin-C-cardiac-Antibody-Immunohistochemistry-Paraffin-NBP2-55151-img0008.jpg "Immunohistochemistry-Paraffin: Troponin C (cardiac) Antibody [NBP2-55151] - Staining of human liver using Anti-TNNC1 antibody.")
![Immunohistochemistry-Paraffin: Troponin C (cardiac) Antibody [NBP2-55151] - Staining of human heart muscle shows high expression.](http://images.novusbio.com/fullsize/Troponin-C-cardiac-Antibody-Immunohistochemistry-Paraffin-NBP2-55151-img0002.jpg "Immunohistochemistry-Paraffin: Troponin C (cardiac) Antibody [NBP2-55151] - Staining of human heart muscle shows high expression.")
![Immunohistochemistry-Paraffin: Troponin C (cardiac) Antibody [NBP2-55151] - Staining of human prostate shows low expression as expected.](http://images.novusbio.com/fullsize/Troponin-C-cardiac-Antibody-Immunohistochemistry-Paraffin-NBP2-55151-img0003.jpg "Immunohistochemistry-Paraffin: Troponin C (cardiac) Antibody [NBP2-55151] - Staining of human prostate shows low expression as expected.")
![Immunohistochemistry-Paraffin: Troponin C (cardiac) Antibody [NBP2-55151] - Staining of human skeletal muscle using Anti-TNNC1 antibody.](http://images.novusbio.com/fullsize/Troponin-C-cardiac-Antibody-Immunohistochemistry-Paraffin-NBP2-55151-img0007.jpg "Immunohistochemistry-Paraffin: Troponin C (cardiac) Antibody [NBP2-55151] - Staining of human skeletal muscle using Anti-TNNC1 antibody.")
![Immunohistochemistry Myosin Heavy Chain Antibody (MF20) [Unconjugated]](https://images.novusbio.com/images2/Myosin_Heavy_Chain_MAB4470_Immunohistochemistry_22971.jpg)
![Immunohistochemistry Myosin Heavy Chain Antibody (MF20) [Unconjugated]](https://images.novusbio.com/images2/Myosin_Heavy_Chain_MAB4470_Immunohistochemistry_22972.jpg)
![Immunocytochemistry Myosin Heavy Chain Antibody (MF20) [Unconjugated]](https://images.novusbio.com/images2/Myosin_Heavy_Chain_MAB4470_Immunocytochemistry_9890.jpg)
![Immunohistochemistry CD34 Antibody [Unconjugated]](https://images.novusbio.com/images2/CD34_AF4117_Immunohistochemistry_6824.jpg)
![N/A MMP-2 [HRP]](https://images.novusbio.com/images2/DATA_MMP2_MMP200_ELISA_1003.jpg)
![N/A MMP-2 [HRP]](https://images.novusbio.com/images2/MMP2_MMP200_ELISA_474.jpg)
![Western Blot Tenascin X Antibody [Unconjugated]](https://images.novusbio.com/images2/Tenascin_X_AF6999_Western_Blot_11365.jpg)
![Immunohistochemistry Tenascin X Antibody [Unconjugated]](https://images.novusbio.com/images2/Tenascin_X_AF6999_Immunohistochemistry_11545.jpg)
![Simple Western Tenascin X Antibody [Unconjugated]](https://images.novusbio.com/images2/Tenascin_X_AF6999_Simple_Western_20232.jpg)
![N/A MMP-9 [HRP]](https://images.novusbio.com/images2/MMP-9_DMP900_ELISA_148.jpg)
![N/A MMP-9 [HRP]](https://images.novusbio.com/images2/DATA_MMP9_DMP900_ELISA_770.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")