TIMM13 Antibody Summary
Description |
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution. |
Immunogen |
Synthetic peptides corresponding to the N terminal of Timm13.
Immunizing peptide sequence FGSDFGGTGGGKLDPGAIMEQVKVQIAVANAQELLQRMTDKCFRKCIGKP. The peptide sequence for this immunogen was taken from within the described region. |
Specificity |
This product is specific to Subunit or Isoform: Tim13. |
Isotype |
IgG |
Clonality |
Polyclonal |
Host |
Rabbit |
Gene |
TIMM13 |
Purity |
Affinity purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
|
Theoretical MW |
10 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Buffer |
PBS, 2% Sucrose |
Preservative |
0.09% Sodium Azide |
Concentration |
0.5 mg/ml |
Purity |
Affinity purified |
Alternate Names for TIMM13 Antibody
Background
Timm13 is a mitochondrial intermembrane chaperone that participates in the import and insertion of some multi-pass transmembrane proteins into the mitochondrial inner membrane. It is also required for the transfer of beta-barrel precursors from the TOM complex to the sorting and assembly machinery (SAM complex) of the outer membrane. It acts as a chaperone-like protein that protects the hydrophobic precursors from aggregation and guide them through the mitochondrial intermembrane space. The TIMM8-TIMM13 complex mediates the import of proteins such as TIMM23, SLC25A12/ARALAR1 and SLC25A13/ARALAR2, while the predominant TIMM9-TIMM10 70 kDa complex mediates the import of much more proteins.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: ELISA, IHC, IHC-P, S-ELISA, WB
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
Species: Hu
Applications: IHC, IHC-P, IP, WB
Species: Mu
Applications: WB
Species: Hu, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA, WB
Species: Hu, Mu, Rt
Applications: ELISA, IHC, IHC-P, S-ELISA, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: IHC-P
Species: Bv, Dr, Hu, Mu
Applications: ChIP, ELISA, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA, S-ELISA, Simple Western, WB
Species: Fi, Hu, Mu, Rt
Applications: ELISA, IHC, KD, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu
Applications: IHC, WB
Species: Hu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KO, WB
Publications for TIMM13 Antibody (NBP1-74226) (0)
There are no publications for TIMM13 Antibody (NBP1-74226).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for TIMM13 Antibody (NBP1-74226) (0)
There are no reviews for TIMM13 Antibody (NBP1-74226).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for TIMM13 Antibody (NBP1-74226) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional TIMM13 Products
Research Areas for TIMM13 Antibody (NBP1-74226)
Find related products by research area.
|
Blogs on TIMM13