Home » TFF3 » TFF3 Antibodies » TFF3 Antibody
Novus Biologicals products are now on bio-techne.com

TFF3 Antibody

 Submit a Review

Images

 
(
Enlarge)
Immunocytochemistry/Immunofluorescence: TFF3 Antibody [NBP2-34007] - Staining of human cell line MCF7 shows localization to nucleus & nucleoli.
Immunocytochemistry/ Immunofluorescence: TFF3 Antibody [NBP2-34007] - Staining of human cell line MCF7 shows localization to nucleus & nucleoli.
Immunohistochemistry-Paraffin: TFF3 Antibody [NBP2-34007] - Staining of human colon shows moderate to strong positivity in mucus in glandular cells.
Immunohistochemistry-Paraffin: TFF3 Antibody [NBP2-34007] - Staining of human small intestine shows distinct positivity in goblet cells.
Orthogonal Strategies: Immunohistochemistry-Paraffin: TFF3 Antibody [NBP2-34007] - Analysis in human colon and skeletal muscle tissues. Corresponding TFF3 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: TFF3 Antibody [NBP2-34007] - Staining of human small intestine shows strong positivity in mucus in glandular cells.
Immunohistochemistry-Paraffin: TFF3 Antibody [NBP2-34007] - Staining of human tonsil shows no positivity in lymphoid cells as expected.
Immunohistochemistry-Paraffin: TFF3 Antibody [NBP2-34007] - Staining of human skeletal muscle shows no positivity in myocytes as expected.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

  

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

TFF3 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: SSAEEYVGLSANQCAVPAKDRVDCGYPHVTPKECNNRGCCFDSRIPGVPWCFKPLQEAECT
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TFF3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:5000 - 1:10000
  • Immunohistochemistry-Paraffin 1:5000 - 1:10000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
TFF3 Protein (NBP2-34007PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for TFF3 Antibody

  • HITF, human intestinal trefoil factor10Intestinal trefoil factor
  • ITF
  • TFF3
  • TFI
  • trefoil factor 3 (intestinal)

Background

Trefoil Factor 3 is a member of the trefoil family are characterized by having at least one copy of the trefoil motif, a 40-amino acid domain that contains three conserved disulfides. They are stable secretory proteins expressed in gastrointestinal mucosa. Their functions are not defined, but they may protect the mucosa from insults, stabilize the mucus layer and affect healing of the epithelium. This gene is expressed in goblet cells of the intestines and colon. Trefoil Factor 3 and two other related trefoil family member genes are found in a cluster on chromosome 21.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

TFF1/pS2 Antibody
NBP1-90813
Immunohistochemistry-Paraffin TFF1/pS2 Antibody
Immunohistochemistry-Paraffin TFF1/pS2 Antibody
Immunohistochemistry-Paraffin TFF1/pS2 Antibody
(1 Review)
(4 Publications)
Species: Hu
Applications: IHC, IHC-P, WB
TFF2 Antibody
(366508) [Unconjugate
MAB4077
Immunohistochemistry TFF2 Antibody (366508) [Unconjugated]
(2 Publications)
Species: Hu
Applications: IHC, WB
MUC2 Antibody
(996/1) - BSA Free
NB120-11197
Flow Cytometry MUC2 Antibody (996/1) - BSA Free
Flow (Intracellular) MUC2 Antibody (996/1) - BSA Free
Flow Cytometry MUC2 Antibody (996/1) - BSA Free
(1 Review)
(11 Publications)
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, WB
Presenilin-2
Antibody (APS 26)
NB100-74513
Immunocytochemistry/ Immunofluorescence Presenilin-2 Antibody (APS 26)
Immunocytochemistry/ Immunofluorescence Presenilin-2 Antibody (APS 26)
Immunocytochemistry/ Immunofluorescence Presenilin-2 Antibody (APS 26)
Species: Hu, Mu, Pm, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB
EGF [Unconjugated]
236-EG
SDS-PAGE EGF [Unconjugated]
Bioactivity EGF [Unconjugated]
Cell Culture EGF [Unconjugated]
(849 Publications)
Species: Hu
Applications: BA
TNF-alpha
[Unconjugated]
210-TA
SDS-PAGE TNF-alpha [Unconjugated]
Bioactivity TNF-alpha [Unconjugated]
SEC-MALS TNF-alpha [Unconjugated]
(3 Reviews)
(818 Publications)
Species: Hu
Applications: BA
EGFR Antibody
[Unconjugated]
AF231
Immunohistochemistry EGFR Antibody [Unconjugated]
Immunocytochemistry EGFR Antibody [Unconjugated]
Western Blot EGFR Antibody [Unconjugated]
(30 Publications)
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, IHC, IP, Simple Western, WB
MUC5AC Antibody
(45M1)
NBP2-15196
Immunohistochemistry-Paraffin MUC5AC Antibody (45M1)
Immunohistochemistry-Paraffin MUC5AC Antibody (45M1)
Immunohistochemistry-Paraffin MUC5AC Antibody (45M1)
(5 Reviews)
(28 Publications)
Species: Bv(-), Ch, Fe, Hu, Ma, Pm, Mu, Po, Rb, Rt
Applications: DB, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, WB
KGF/FGF-7
[Unconjugated]
251-KG
Bioactivity KGF/FGF-7 [Unconjugated]
Bioactivity KGF/FGF-7 [Unconjugated]
(85 Publications)
Species: Hu
Applications: BA
c-Fos Antibody
(2H2)
NBP2-50037
Western Blot c-Fos Antibody (2H2)
Immunocytochemistry/ Immunofluorescence c-Fos Antibody (2H2)
Immunocytochemistry/ Immunofluorescence c-Fos Antibody (2H2)
(1 Review)
(20 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, KO, WB
IL-6 [HRP]
M6000B
N/A IL-6 [HRP]
N/A IL-6 [HRP]
N/A IL-6 [HRP]
(667 Publications)
Species: Mu
Applications: ELISA
Myelin Protein
Zero Antibody
NB100-1607
Immunohistochemistry Myelin Protein Zero Antibody
Immunocytochemistry/ Immunofluorescence Myelin Protein Zero Antibody
(16 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IP, WB
MUC1 Antibody
(SM3) - BSA Free
NB120-22711
Immunocytochemistry/ Immunofluorescence MUC1 Antibody (SM3) - BSA Free
Flow Cytometry MUC1 Antibody (SM3) - BSA Free
Immunocytochemistry/ Immunofluorescence MUC1 Antibody (SM3) - BSA Free
(14 Publications)
Species: Hu, Mu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
PMP22 Antibody
(Hu1) - Azide and BSA ...
NBP2-80913
Immunohistochemistry PMP22 Antibody (Hu1) - Azide and BSA Free
Species: Bv(-), Hu, Mu(-), Pm, Rt(-)
Applications: IHC, IHC-P, WB
ERK2 Antibody
[Unconjugated]
AF1230
Western Blot ERK2 Antibody [Unconjugated]
Immunohistochemistry ERK2 Antibody [Unconjugated]
Knockout Validated ERK2 Antibody [Unconjugated]
(3 Publications)
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
DAX1/NR0B1
Antibody (H7431)
PP-H7431-00
DAX1/NR0B1 Antibody (H7431)
(2 Publications)
Species: Hu
Applications: WB
ERK1 Antibody
(1E5) - BSA Free
NBP2-22203
Flow Cytometry ERK1 Antibody (1E5) - BSA Free
Immunocytochemistry/ Immunofluorescence ERK1 Antibody (1E5) - BSA Free
Immunohistochemistry-Paraffin ERK1 Antibody (1E5) - BSA Free
(1 Publication)
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
COX-2 Antibody
NB100-689
Immunohistochemistry-Paraffin COX-2 Antibody
Simple Western COX-2 Antibody
(1 Review)
(36 Publications)
Species: Hu, Rt
Applications: IHC, IHC-Fr, IHC-P, Simple Western, WB

Publications for TFF3 Antibody (NBP2-34007) (0)

There are no publications for TFF3 Antibody (NBP2-34007).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TFF3 Antibody (NBP2-34007) (0)

There are no reviews for TFF3 Antibody (NBP2-34007). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for TFF3 Antibody (NBP2-34007) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TFF3 Products

Research Areas for TFF3 Antibody (NBP2-34007)

Find related products by research area.

Blogs on TFF3

There are no specific blogs for TFF3, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TFF3 Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol TFF3
Uniprot