![Immunohistochemistry: TET2 Antibody [NBP3-35520] - Immunohistochemistry analysis of paraffin-embedded Rat bone marrow using TET2 Rabbit pAb at dilution of 1:100 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.](http://images.novusbio.com/fullsize/nbp3-35520_rabbit-tet2-pab-912202415143621.jpg "Immunohistochemistry: TET2 Antibody [NBP3-35520] - Immunohistochemistry analysis of paraffin-embedded Rat bone marrow using TET2 Rabbit pAb at dilution of 1:100 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, ELISA, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1833-2002 of human TET2 (NP_001120680.1). Sequence: VQGVASGAEDNDEVWSDSEQSFLDPDIGGVAVAPTHGSILIECAKRELHATTPLKNPNRNHPTRISLVFYQHKSMNEPKHGLALWEAKMAEKAREKEEECEKYGPDYVPQKSHGKKVKREPAEPHETSEPTYLRFIKSLAERTMSVTTDSTVTTSPYAFTRVTGPYNRYI |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | TET2 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Theoretical MW | 224 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
| Storage | Store at -20C. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.3), 50% glycerol |
| Preservative | 0.05% Proclin 300 |
| Purity | Affinity purified |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | TET2 |
![Western Blot: TET2 Antibody [NBP3-35520] - Western blot analysis of lysates from Mouse heart, using TET2 Rabbit pAb at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 10s.](http://images.novusbio.com/fullsize/nbp3-35520_rabbit-tet2-pab-91220241412380.jpg "Western Blot: TET2 Antibody [NBP3-35520] - Western blot analysis of lysates from Mouse heart, using TET2 Rabbit pAb at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 10s.")
![Immunohistochemistry: TET2 Antibody [NBP3-35520] - Immunohistochemistry analysis of paraffin-embedded Human colon using TET2 Rabbit pAb at dilution of 1:100 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.](http://images.novusbio.com/fullsize/nbp3-35520_rabbit-tet2-pab-912202414154364.jpg "Immunohistochemistry: TET2 Antibody [NBP3-35520] - Immunohistochemistry analysis of paraffin-embedded Human colon using TET2 Rabbit pAb at dilution of 1:100 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.")
![N/A Erythropoietin/EPO [HRP]](https://images.novusbio.com/images2/DATA_Erythropoietin_MEP00_ELISA_970.jpg)
![N/A Erythropoietin/EPO [HRP]](https://images.novusbio.com/images2/Erythropoietin_MEP00_ELISA_421.jpg)
![Immunohistochemistry CD34 Antibody [Unconjugated]](https://images.novusbio.com/images2/CD34_AF4117_Immunohistochemistry_6824.jpg)
![Neutralization G-CSF Antibody (67604) [Unconjugated]](https://images.novusbio.com/images2/G-CSF_MAB414_Block_Neutralize_9188.jpg)
![SDS-PAGE TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNF-alpha_210-TA_256.jpg)
![Bioactivity TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNFalpha_210TA_1658.jpg)
![SEC-MALS TNF-alpha [Unconjugated]](https://images.novusbio.com/images/210-ta_recombinant-human-tnf-alpha-protein-sec-mals-35202312244..jpg)
![Bioactivity GM-CSF [Unconjugated]](https://images.novusbio.com/images/protein/7954-gmcf_recombinant-human-gm-csf-cho-expressed-protein-cf-bioactivity-272020121514.jpg)
![Bioactivity CTLA-4 [Unconjugated]](https://images.novusbio.com/images2/CTLA4_7268CT_2293.jpg)
![Flow Cytometry Flt-3/Flk-2/CD135 Antibody (66903) [Unconjugated]](https://images.novusbio.com/images/antibody/mab812_human-flt-3-flk-2-mab-clone-66903-flow-cytometry-3112023131157..jpg)
![Flow Cytometry Flt-3/Flk-2/CD135 Antibody (66903) [Unconjugated]](https://images.novusbio.com/images/antibody/mab812_human-flt-3-flk-2-mab-clone-66903-flow-cytometry-3112023131255..jpg)
![Knockout Validated Isocitrate Dehydrogenase 1/IDH1 Antibody (843219) [Unconjugated]](https://images.novusbio.com/images2/Isocitrate_Dehydrogenase_1_MAB7049_Knockout_Validated_22540.jpg)
![Immunocytochemistry Isocitrate Dehydrogenase 1/IDH1 Antibody (843219) [Unconjugated]](https://images.novusbio.com/images2/Isocitrate_Dehydrogenase_1_MAB7049_Immunocytochemistry__Immunofluorescence_19067.jpg)
![Western Blot Isocitrate Dehydrogenase 1/IDH1 Antibody (843219) [Unconjugated]](https://images.novusbio.com/images2/Isocitrate_Dehydrogenase_1_MAB7049_Western_Blot_13853.jpg)
![SDS-PAGE IL-3 [Unconjugated]](https://images.novusbio.com/images2/IL-3_203-IL_345.jpg)
![Bioactivity IL-3 [Unconjugated]](https://images.novusbio.com/images2/IL-3_203-IL_347.jpg)
![SEC-MALS IL-3 [Unconjugated]](https://images.novusbio.com/images/203-il_recombinant-human-il-3-protein-sec-mals-133202482656..jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")