![Western Blot: TAX1BP1 Antibody [NBP1-86662] - Western blot shows lysates of HEK293T human embryonic kidney parental cell line and TAX1BP1 knockout (KO) HEK293T cell line. PVDF membrane was probed with 1.0 ug/ml of Rabbit Anti-Human TAX1BP1 Polyclonal Antibody (Catalog # NBP1-86662) followed by HRP-conjugated Anti-Rabbit IgG Secondary Antibody (Catalog #HAF008). Specific band was detected for TAX1BP1 at approximately 90 kDa (as indicated) in the parental HEK293T cell line, but is not detectable in the knockout HEK293T cell line. This experiment was conducted under reducing conditions.](http://images.novusbio.com/fullsize/TAX1BP1-Antibody-Knockdown-Validated-NBP1-86662-img0010.jpg "Western Blot: TAX1BP1 Antibody [NBP1-86662] - Western blot shows lysates of HEK293T human embryonic kidney parental cell line and TAX1BP1 knockout (KO) HEK293T cell line. PVDF membrane was probed with 1.0 ug/ml of Rabbit Anti-Human TAX1BP1 Polyclonal Antibody (Catalog # NBP1-86662) followed by HRP-conjugated Anti-Rabbit IgG Secondary Antibody (Catalog #HAF008). Specific band was detected for TAX1BP1 at approximately 90 kDa (as indicated) in the parental HEK293T cell line, but is not detectable in the knockout HEK293T cell line. This experiment was conducted under reducing conditions.")
| Reactivity | HuSpecies Glossary |
| Applications | WB, ICC/IF, IHC, KD, KO |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: ADAVAELKLNAMKKDQDKTDTLEHELRREVEDLKLRLQMAADHYKEKFKECQRLQKQINKLSDQSANNNNVFTKKTGNQQKVNDASVNTDPATSASTVDVKPSPSAAEADFDIVTKGQVCEMTKEIADKTEKYNK |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | TAX1BP1 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for TAX1BP1 Antibody (NBP1-86662)Find related products by research area.
|
|
Understanding Mitophagy Mechanisms: Canonical PINK1/Parkin, LC3-Dependent Piecemeal, and LC3-Independent Mitochondrial Derived Vesicles By Christina Towers, PhD What is Mitophagy?The selective degradation of mitochondria via double membrane autophagosome vesicles is called mitophagy. Damaged mitochondria can generate harmful amounts of reactive ox... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | TAX1BP1 |
![Western Blot: TAX1BP1 Antibody [NBP1-86662] - Western blot shows lysates of HeLa, HEK293T and U251-MG cell lines. PVDF membrane was probed with 0.1 ug/ml of Rabbit Anti-Human TAX1BP1 Polyclonal Antibody (Catalog # NBP1-86662) followed by HRP-conjugated Anti-Rabbit IgG Secondary Antibody (Catalog #HAF008). Specific band was detected for TAX1BP1 at approximately 90 kDa (as indicated). This experiment was conducted under reducing conditions.](http://images.novusbio.com/fullsize/TAX1BP1-Antibody-Western-Blot-NBP1-86662-img0009.jpg "Western Blot: TAX1BP1 Antibody [NBP1-86662] - Western blot shows lysates of HeLa, HEK293T and U251-MG cell lines. PVDF membrane was probed with 0.1 ug/ml of Rabbit Anti-Human TAX1BP1 Polyclonal Antibody (Catalog # NBP1-86662) followed by HRP-conjugated Anti-Rabbit IgG Secondary Antibody (Catalog #HAF008). Specific band was detected for TAX1BP1 at approximately 90 kDa (as indicated). This experiment was conducted under reducing conditions.")
![Immunocytochemistry/Immunofluorescence: TAX1BP1 Antibody [NBP1-86662] - Staining of human cell line U-2 OS shows localization to cytosol. Antibody staining is shown in green.](http://images.novusbio.com/fullsize/TAX1BP1-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-86662-img0005.jpg "Immunocytochemistry/Immunofluorescence: TAX1BP1 Antibody [NBP1-86662] - Staining of human cell line U-2 OS shows localization to cytosol. Antibody staining is shown in green.")
![Immunohistochemistry-Paraffin: TAX1BP1 Antibody [NBP1-86662] - Staining of human testis shows strong cytoplasmic positivity in cells in seminiferous ducts.](http://images.novusbio.com/fullsize/TAX1BP1-Antibody-Immunohistochemistry-Paraffin-NBP1-86662-img0007.jpg "Immunohistochemistry-Paraffin: TAX1BP1 Antibody [NBP1-86662] - Staining of human testis shows strong cytoplasmic positivity in cells in seminiferous ducts.")
![Immunohistochemistry-Paraffin: TAX1BP1 Antibody [NBP1-86662] - Staining of human prostate shows strong cytoplasmic positivity in glandular cells.](http://images.novusbio.com/fullsize/TAX1BP1-Antibody-Immunohistochemistry-Paraffin-NBP1-86662-img0006.jpg "Immunohistochemistry-Paraffin: TAX1BP1 Antibody [NBP1-86662] - Staining of human prostate shows strong cytoplasmic positivity in glandular cells.")
![Immunohistochemistry-Paraffin: TAX1BP1 Antibody [NBP1-86662] - Staining of human placenta shows strong cytoplasmic positivity in trophoblastic cells.](http://images.novusbio.com/fullsize/TAX1BP1-Antibody-Immunohistochemistry-Paraffin-NBP1-86662-img0008.jpg "Immunohistochemistry-Paraffin: TAX1BP1 Antibody [NBP1-86662] - Staining of human placenta shows strong cytoplasmic positivity in trophoblastic cells.")
![SDS-PAGE TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNF-alpha_210-TA_256.jpg)
![Bioactivity TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNFalpha_210TA_1658.jpg)
![SEC-MALS TNF-alpha [Unconjugated]](https://images.novusbio.com/images/210-ta_recombinant-human-tnf-alpha-protein-sec-mals-35202312244..jpg)
![Immunohistochemistry Contactin-2/TAG1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Contactin-2_AF4439_Immunohistochemistry_10516.jpg)
![Simple Western Contactin-2/TAG1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Contactin2_AF4439_Simple_Western_17121.jpg)
![Western Blot Contactin-2/TAG1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Contactin-2_AF4439_Western_Blot_9589.jpg)
![Western Blot JNK1 Antibody (228601) [Unconjugated]](https://images.novusbio.com/images2/JNK1_MAB17761_Western_Blot_5991.jpg)
![Western Blot JNK1 Antibody (228601) [Unconjugated]](https://images.novusbio.com/images2/JNK1_MAB17761_Western_Blot_6327.jpg)
![Immunocytochemistry JNK1 Antibody (228601) [Unconjugated]](https://images.novusbio.com/images2/JNK1_MAB17761_Immunocytochemistry__Immunofluorescence_20184.jpg)
![SDS-PAGE IL-1 beta/IL-1F2 [Unconjugated]](https://images.novusbio.com/images2/IL-1_beta_201-LB_304.jpg)
![Bioactivity IL-1 beta/IL-1F2 [Unconjugated]](https://images.novusbio.com/images2/IL-1_beta_201-LB_306.jpg)
![SEC-MALS IL-1 beta/IL-1F2 [Unconjugated]](https://images.novusbio.com/images/201-lb_recombinant-human-il-1-beta-il-1f2-protein-sec-mals-123202491556.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")