Home » Tapasin » Tapasin Proteins » Tapasin Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

Tapasin Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for Tapasin Recombinant Protein Antigen (NBP1-86968PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

Tapasin Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human TAPBP.

Source: E. coli

Amino Acid Sequence: QEGTYLATIHLPYLQGQVTLELAVYKPPKVSLMPATLARAAPGEAPPELLCLVSHFYPSGGLEVEWELRGGPGGRSQKAEGQRWLSALRHHSDGSVSLSGHLQPPPVTTEQHGARYACRIHHPS

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
TAPBP
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-86968.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
31 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Tapasin Recombinant Protein Antigen

  • NGS17
  • NGS-17
  • TAP binding protein (tapasin)
  • TAP Binding Protein
  • TAPA
  • Tapasin
  • TAPATAP-associated protein
  • TAPBP
  • TPN
  • TPSN
  • TPSNTAP-binding protein

Background

TAPBP - TAP binding protein (tapasin)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

SEC14L2 Antibody
(OTI4H2)
NBP2-01346
Flow Cytometry SEC14L2 Antibody (OTI4H2)
Western Blot SEC14L2 Antibody (OTI4H2)
Immunohistochemistry-Paraffin SEC14L2 Antibody (OTI4H2)
Species: Ca, Hu, Pm, Mu, Pm, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
TAP1 Antibody (3D4)
H00006890-M04
Flow Cytometry TAP1 Antibody (3D4)
Immunocytochemistry/ Immunofluorescence TAP1 Antibody (3D4)
(1 Review)
Species: Hu
Applications: ELISA, Flow, ICC/IF, WB
NXF1 Antibody
NBP1-31649
Immunohistochemistry-Paraffin NXF1 Antibody
Western Blot NXF1 Antibody
Immunocytochemistry/ Immunofluorescence NXF1 Antibody
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Filamin B Antibody
NBP1-90286
Immunocytochemistry/ Immunofluorescence Filamin B Antibody
Western Blot Filamin B Antibody
Immunohistochemistry-Paraffin Filamin B Antibody
(2 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
VDP p115 Antibody
NBP3-38014
Immunocytochemistry/ Immunofluorescence VDP p115 Antibody
Immunohistochemistry VDP p115 Antibody
Western Blot VDP p115 Antibody
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Calreticulin
Antibody - BSA Free
NB600-101
Knockdown Validated Calreticulin Antibody - BSA Free
Western Blot Calreticulin Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence Calreticulin Antibody - BSA Free
(28 Publications)
Species: Bv, Ha, Hu, Mu, Pm, Rt
Applications: B/N, DB, EM, Flow, ICC/IF, IHC, IHC-P, IP, KD, PA, Simple Western, WB
ERp57/PDIA3
Antibody
NBP1-84796
Western Blot ERp57/PDIA3 Antibody
Immunohistochemistry-Paraffin ERp57/PDIA3 Antibody
Immunohistochemistry-Paraffin ERp57/PDIA3 Antibody
(4 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, WB
TAP2 Antibody -
Azide and BSA Free
NBP2-93797
Immunohistochemistry-Paraffin TAP2 Antibody - Azide and BSA Free
Immunocytochemistry/ Immunofluorescence TAP2 Antibody - Azide and BSA Free
Immunocytochemistry/ Immunofluorescence TAP2 Antibody - Azide and BSA Free
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
SEC14L3 Antibody
NBP2-31769
Immunohistochemistry SEC14L3 Antibody
Immunohistochemistry SEC14L3 Antibody
Immunohistochemistry SEC14L3 Antibody
Species: Hu
Applications: IHC, IHC-P
Albumin Antibody
(188835) [Unconjugate ...
MAB1455
Simple Western Albumin Antibody (188835) [Unconjugated] - Serum
Immunocytochemistry Albumin Antibody (188835) [Unconjugated] - Serum
Immunohistochemistry Albumin Antibody (188835) [Unconjugated] - Serum
(3 Reviews)
(54 Publications)
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ICC, IHC, ICFlow, Simple Western, WB
Calnexin Antibody
- BSA Free
NB100-1965
Western Blot Calnexin Antibody - BSA Free
Immunohistochemistry Calnexin Antibody - BSA Free
Immunohistochemistry Calnexin Antibody - BSA Free
(3 Reviews)
(46 Publications)
Species: Av, Bv, Ch, Dr, Gp, Hu, Mu, Po, Rb, Rt, Sh, Xp, Ze
Applications: Flow, ICC/IF, IHC, IHC-P, IP, Simple Western, WB
Insulin Antibody
(182410) [Unconjugate ...
MAB1417
Immunocytochemistry Insulin Antibody (182410) [Unconjugated]
Immunohistochemistry Insulin Antibody (182410) [Unconjugated]
(24 Publications)
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
MHC Class I
Antibody (OX18) - BSA
NB120-6405
Flow Cytometry MHC Class I Antibody (OX18) - BSA Free
Immunocytochemistry/ Immunofluorescence MHC Class I Antibody (OX18) - BSA Free
Immunocytochemistry/ Immunofluorescence MHC Class I Antibody (OX18) - BSA Free
(36 Publications)
Species: Rt
Applications: B/N, CyTOF-ready, EM, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
TNF-alpha
[Unconjugated]
210-TA
SDS-PAGE TNF-alpha [Unconjugated]
Bioactivity TNF-alpha [Unconjugated]
SEC-MALS TNF-alpha [Unconjugated]
(3 Reviews)
(818 Publications)
Species: Hu
Applications: BA
IGF-I/IGF-1
[Unconjugated]
291-G1
SDS-PAGE IGF-I/IGF-1 [Unconjugated]
Bioactivity IGF-I/IGF-1 [Unconjugated]
Mass Spectrometry IGF-I/IGF-1 [Unconjugated]
(224 Publications)
Species: Hu
Applications: BA
HLA B Antibody
(2G7B10) - BSA Free
NBP2-61871
ELISA HLA B Antibody (2G7B10) - BSA Free
Flow Cytometry HLA B Antibody (2G7B10) - BSA Free
Immunocytochemistry/ Immunofluorescence HLA B Antibody (2G7B10) - BSA Free
Species: Hu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
LMP2/PSMB9
Antibody (OTI1D1)
NBP2-01817
Western Blot LMP2/PSMB9 Antibody (OTI1D1)
Flow Cytometry LMP2/PSMB9 Antibody (OTI1D1)
Immunocytochemistry/ Immunofluorescence LMP2/PSMB9 Antibody (OTI1D1)
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB

5'-Nucleotidase/CD73 A ...
NBP2-48480
Flow (Cell Surface) 5'-Nucleotidase/CD73 Antibody (AD2) - BSA Free
Flow (Cell Surface) 5'-Nucleotidase/CD73 Antibody (AD2) - BSA Free
Flow Cytometry 5'-Nucleotidase/CD73 Antibody (AD2) - BSA Free
(1 Review)
(15 Publications)
Species: Hu
Applications: Flow-CS, Flow, IHC, IHC-Fr, IHC-P
CD8 Antibody
(53-6.7) - BSA Free
NBP1-49045
Immunohistochemistry-Paraffin CD8 Antibody (53-6.7) - BSA Free
Immunocytochemistry/ Immunofluorescence CD8 Antibody (53-6.7) - BSA Free
Immunohistochemistry-Frozen CD8 Antibody (53-6.7) - BSA Free
(3 Reviews)
(28 Publications)
Species: Mu, Rt
Applications: Cell Depl, CyTOF-ready, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, InhibTFunc
LMP7/PSMB8
Antibody (1B3)
H00005696-M01
Western Blot LMP7/PSMB8 Antibody (1B3)
Immunocytochemistry/ Immunofluorescence LMP7/PSMB8 Antibody (1B3)
Immunohistochemistry-Paraffin LMP7/PSMB8 Antibody (1B3)
(3 Publications)
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB

Publications for Tapasin Recombinant Protein Antigen (NBP1-86968PEP) (0)

There are no publications for Tapasin Recombinant Protein Antigen (NBP1-86968PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Tapasin Recombinant Protein Antigen (NBP1-86968PEP) (0)

There are no reviews for Tapasin Recombinant Protein Antigen (NBP1-86968PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Tapasin Recombinant Protein Antigen (NBP1-86968PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Tapasin Products

Array NBP1-86968PEP

Blogs on Tapasin

There are no specific blogs for Tapasin, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
TNF-alpha [Unconjugated]
210-TA-005
Simple Western lane view shows lysates of human serum, loaded at 1:25000. A specific band was detected for Albumin at approximately 64 kDa (as indicated) using 1 µg/mL of Mouse Anti-Human Serum Albumin Monoclonal Antibody (Catalog # MAB1455) . This experiment was conducted under reducing conditions and using the 12-230 kDa separation system.
Albumin Antibody (188835) [Unconjugated] - Serum
MAB1455

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Tapasin Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol TAPBP