![Immunohistochemistry-Paraffin: Syntaxin-BP1 Antibody [NBP1-83139] - Analysis in human cerebral cortex and liver tissues using NBP1-83139 antibody. Corresponding STXBP1 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/Syntaxin-BP1-Antibody-Immunohistochemistry-Paraffin-NBP1-83139-img0012.jpg "Immunohistochemistry-Paraffin: Syntaxin-BP1 Antibody [NBP1-83139] - Analysis in human cerebral cortex and liver tissues using NBP1-83139 antibody. Corresponding STXBP1 RNA-seq data are presented for the same tissues.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: TDSCPDALFNELVKSRAAKVIKTLTEINIAFLPYESQVYSLDSADSFQSFYSPHKAQMKNPILERLAEQIATLCATLKEYPAVRYRGEYKDNALLAQLIQDKLDAYKADDPT |
| Predicted Species | Mouse (100%), Rat (100%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | STXBP1 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Western Blot AKT [p Ser473] Antibody [Unconjugated] - Pan Specific](https://images.novusbio.com/images2/Akt3_AF887_Western_Blot_5930.jpg)
![Simple Western AKT [p Ser473] Antibody [Unconjugated] - Pan Specific](https://images.novusbio.com/images2/16332.jpg)
![Intracellular Staining by Flow Cytometry AKT [p Ser473] Antibody [Unconjugated] - Pan Specific](https://images.novusbio.com/images2/Akt3_AF887_Flow_Cytometry_8283.jpg)
Secondary Antibodies |
Isotype Controls |
Research Areas for Syntaxin-BP1 Antibody (NBP1-83139)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | STXBP1 |
![Western Blot: Syntaxin-BP1 Antibody [NBP1-83139] - Analysis in human cell line SCLC-21H.](http://images.novusbio.com/fullsize/Syntaxin-BP1-Antibody-Western-Blot-NBP1-83139-img0016.jpg "Western Blot: Syntaxin-BP1 Antibody [NBP1-83139] - Analysis in human cell line SCLC-21H.")
![Immunocytochemistry/Immunofluorescence: Syntaxin-BP1 Antibody [NBP1-83139] - Staining of human cell line SK-MEL-30 shows localization to nucleoplasm & cytosol. Antibody staining is shown in green.](http://images.novusbio.com/fullsize/Syntaxin-BP1-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-83139-img0007.jpg "Immunocytochemistry/Immunofluorescence: Syntaxin-BP1 Antibody [NBP1-83139] - Staining of human cell line SK-MEL-30 shows localization to nucleoplasm & cytosol. Antibody staining is shown in green.")
![Immunohistochemistry-Paraffin: Syntaxin-BP1 Antibody [NBP1-83139] - Staining of human liver shows no positivity in hepatocytes as expected.](http://images.novusbio.com/fullsize/Syntaxin-BP1-Antibody-Immunohistochemistry-Paraffin-NBP1-83139-img0014.jpg "Immunohistochemistry-Paraffin: Syntaxin-BP1 Antibody [NBP1-83139] - Staining of human liver shows no positivity in hepatocytes as expected.")
![Immunohistochemistry-Paraffin: Syntaxin-BP1 Antibody [NBP1-83139] - Staining of human pancreas shows low expression as expected.](http://images.novusbio.com/fullsize/Syntaxin-BP1-Antibody-Immunohistochemistry-Paraffin-NBP1-83139-img0011.jpg "Immunohistochemistry-Paraffin: Syntaxin-BP1 Antibody [NBP1-83139] - Staining of human pancreas shows low expression as expected.")
![Immunohistochemistry-Paraffin: Syntaxin-BP1 Antibody [NBP1-83139] - Staining of human cerebellum shows strong positivity in molecular layer.](http://images.novusbio.com/fullsize/Syntaxin-BP1-Antibody-Immunohistochemistry-Paraffin-NBP1-83139-img0013.jpg "Immunohistochemistry-Paraffin: Syntaxin-BP1 Antibody [NBP1-83139] - Staining of human cerebellum shows strong positivity in molecular layer.")
![Immunohistochemistry-Paraffin: Syntaxin-BP1 Antibody [NBP1-83139] - Staining of human pancreas shows no positivity in exocrine glandular cells as expected.](http://images.novusbio.com/fullsize/Syntaxin-BP1-Antibody-Immunohistochemistry-Paraffin-NBP1-83139-img0015.jpg "Immunohistochemistry-Paraffin: Syntaxin-BP1 Antibody [NBP1-83139] - Staining of human pancreas shows no positivity in exocrine glandular cells as expected.")
![Immunocytochemistry SCGF/CLEC11a Antibody (239029) [Unconjugated]](https://images.novusbio.com/images2/SCGF_MAB1904_Immunocytochemistry_6578.jpg)
![Immunohistochemistry SCGF/CLEC11a Antibody (239029) [Unconjugated]](https://images.novusbio.com/images2/SCGF_MAB1904_Immunohistochemistry_6959.jpg)
![Immunohistochemistry SCGF/CLEC11a Antibody (239029) [Unconjugated]](https://images.novusbio.com/images/mab1904_human-scgf-clec11a-mab-clone-239029-4120241252123.jpg)
![Western Blot ERK2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ERK2_AF1230_Western_Blot_5097.jpg)
![Immunohistochemistry ERK2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ERK2_AF1230_Immunohistochemistry_20696.jpg)
![Knockout Validated ERK2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ERK2_AF1230_Knockout_Validated_22864.jpg)
![Immunohistochemistry p63/TP73L Antibody [Unconjugated]](https://images.novusbio.com/images2/p63_AF1916_Immunohistochemistry_16919.jpg)
![Immunocytochemistry p63/TP73L Antibody [Unconjugated]](https://images.novusbio.com/images2/p63_AF1916_Immunocytochemistry__Immunofluorescence_16973.jpg)
![Immunocytochemistry/ Immunofluorescence p63/TP73L Antibody [Unconjugated]](https://images.novusbio.com/images/af1916_human-p63-tp73l-affinity-purified-polyclonal-ab-41202412401237.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")