Home » ST8 alpha-2,8-Sialyltransferase 8B/ST8SIA2 » ST8 alpha-2,8-Sialyltransferase 8B/ST8SIA2 Proteins » ST8 alpha-2,8-Sialyltransferase 8B/ST8SIA2 Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

ST8 alpha-2,8-Sialyltransferase 8B/ST8SIA2 Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for ST8 alpha-2,8-Sialyltransferase 8B/ST8SIA2 Recombinant Protein Antigen (NBP3-17939PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

ST8 alpha-2,8-Sialyltransferase 8B/ST8SIA2 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human ST8 alpha-2,8-Sialyltransferase 8B/ST8SIA2

Source: E. coli

Amino Acid Sequence: EEEIGNSGGRGTIRSAVNSLHSKSNRAEVVINGSSSPAVVDRSNESIKHNIQPASSKWRHNQTLSLRIRKQI

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
ST8SIA2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10-100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP3-17939.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
25 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for ST8 alpha-2,8-Sialyltransferase 8B/ST8SIA2 Recombinant Protein Antigen

  • alpha-2,8-sialyltransferase 8B 1
  • alpha-2,8-sialyltransferase 8B
  • EC 2.4.99
  • EC 2.4.99.-
  • HsT19690
  • MGC116854
  • MGC116857
  • sialyltransferase 8 (alpha-2, 8-sialytransferase) B
  • Sialyltransferase 8B
  • Sialyltransferase X
  • Sialytransferase St8Sia II
  • SIAT8B
  • SIAT8-B
  • ST8 alpha-N-acetyl-neuraminide alpha-2,8-sialyltransferase 2
  • ST8SIA2
  • ST8SiaII
  • ST8SIA-II
  • STX
  • STXST8SiaII

Background

ST8SIA2 is encoded by this gene is a type II membrane protein that is thought to catalyze the transfer of sialic acid from CMP-sialic acid to N-linked oligosaccharides and glycoproteins. The encoded protein may be found in the Golgi apparatus and may be involved in the production of polysialic acid, a modulator of the adhesive properties of neural cell adhesion molecule (NCAM1). This protein is a member of glycosyltransferase family 29.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...


Epimorphin/Syntaxin 2 ...
MAB2568
Immunohistochemistry Epimorphin/Syntaxin 2 Antibody (338930) [Unconjugated]
Species: Mu
Applications: IHC, WB
Syntaxin 1A
Antibody (2B2F10)
NBP3-15706
Immunohistochemistry-Paraffin Syntaxin 1A Antibody (2B2F10)
Immunohistochemistry Syntaxin 1A Antibody (2B2F10)
Immunohistochemistry Syntaxin 1A Antibody (2B2F10)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
ST8
alpha-2,8-Sialyltrans ...
7027-GT
ST8 alpha-2,8-Sialyltransferase 4/ST8SIA4 [Unconjugated]
Species: Hu, Wf
Applications: EnzAct
Complement Factor
H Antibody [Unconjuga ...
AF4779
Immunohistochemistry Complement Factor H Antibody [Unconjugated]
(1 Review)
(2 Publications)
Species: Hu
Applications: IHC, WB
NCAM-1/CD56
Antibody [Unconjugate
AF2408
Western Blot NCAM-1/CD56 Antibody [Unconjugated]
Simple Western NCAM-1/CD56 Antibody [Unconjugated]
Immunocytochemistry NCAM-1/CD56 Antibody [Unconjugated]
(24 Publications)
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC, KO, Simple Western, WB
TNF-alpha
[Unconjugated]
210-TA
SDS-PAGE TNF-alpha [Unconjugated]
Bioactivity TNF-alpha [Unconjugated]
SEC-MALS TNF-alpha [Unconjugated]
(3 Reviews)
(817 Publications)
Species: Hu
Applications: BA
Cytosolic
Sulfotransferase 1A1/ ...
NBP2-03227
Flow Cytometry Cytosolic Sulfotransferase 1A1/SULT1A1 Antibody (OTI9B7)
Flow Cytometry Cytosolic Sulfotransferase 1A1/SULT1A1 Antibody (OTI9B7)
Western Blot Cytosolic Sulfotransferase 1A1/SULT1A1 Antibody (OTI9B7)
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Kallikrein 3/PSA
[HRP]
DKK300
N/A Kallikrein 3/PSA [HRP]
N/A Kallikrein 3/PSA [HRP]
N/A Kallikrein 3/PSA [HRP]
(17 Publications)
Species: Hu
Applications: ELISA
PSAT1 Antibody
NBP1-32920
Western Blot PSAT1 Antibody
Immunocytochemistry/ Immunofluorescence PSAT1 Antibody
Immunohistochemistry-Paraffin PSAT1 Antibody
(12 Publications)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, KD, WB
Protein S/PROS1
Antibody [Unconjugate
AF4036
Western Blot Protein S/PROS1 Antibody [Unconjugated]
Simple Western Protein S/PROS1 Antibody [Unconjugated]
(7 Publications)
Species: Hu
Applications: Simple Western, WB
PLAG1 Antibody
(3B7)
H00005324-M02
Immunohistochemistry PLAG1 Antibody (3B7)
Immunohistochemistry PLAG1 Antibody (3B7)
ELISA PLAG1 Antibody (3B7)
(20 Publications)
Species: Hu, Mu
Applications: ELISA, IHC, IHC-P, WB

Puromycin-sensitive am ...
NBP2-13669
Immunohistochemistry-Paraffin Puromycin-sensitive aminopeptidase/NPEPPS Antibody
Immunohistochemistry Puromycin-sensitive aminopeptidase/NPEPPS Antibody
Immunohistochemistry-Paraffin Puromycin-sensitive aminopeptidase/NPEPPS Antibody
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Syntaxin-BP3/Munc18c A ...
AF5659
Western Blot Syntaxin-BP3/Munc18c Antibody [Unconjugated]
Species: Hu
Applications: WB
Reg1A Antibody
(431202) [Unconjugate
MAB4937
Intracellular Staining by Flow Cytometry Reg1A Antibody (431202) [Unconjugated]
(2 Publications)
Species: Hu
Applications: CyTOF-ready, ICFlow, WB
PSP94/MSMB
Antibody (OTI6C7)
NBP2-02450
Western Blot PSP94/MSMB Antibody (OTI6C7)
Immunocytochemistry/ Immunofluorescence PSP94/MSMB Antibody (OTI6C7)
Immunohistochemistry-Paraffin PSP94/MSMB Antibody (OTI6C7)
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
HRSP12 Antibody
NBP1-82452
Western Blot HRSP12 Antibody
Western Blot HRSP12 Antibody
Immunohistochemistry-Paraffin HRSP12 Antibody
(1 Publication)
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
PSP/BPIFA2
Antibody (1F12) - BSA
NBP2-37493
ELISA PSP/BPIFA2 Antibody (1F12) - BSA Free
Western Blot PSP/BPIFA2 Antibody (1F12) - BSA Free
Immunocytochemistry/ Immunofluorescence PSP/BPIFA2 Antibody (1F12) - BSA Free
(1 Publication)
Species: Hu, Mu, Po
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, WB
ST8
alpha-2,8-Sialyltrans ...
NBP3-17939PEP
ST8 alpha-2,8-Sialyltransferase 8B/ST8SIA2 Recombinant Protein Antigen
Species: Hu
Applications: AC

Publications for ST8 alpha-2,8-Sialyltransferase 8B/ST8SIA2 Recombinant Protein Antigen (NBP3-17939PEP) (0)

There are no publications for ST8 alpha-2,8-Sialyltransferase 8B/ST8SIA2 Recombinant Protein Antigen (NBP3-17939PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ST8 alpha-2,8-Sialyltransferase 8B/ST8SIA2 Recombinant Protein Antigen (NBP3-17939PEP) (0)

There are no reviews for ST8 alpha-2,8-Sialyltransferase 8B/ST8SIA2 Recombinant Protein Antigen (NBP3-17939PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for ST8 alpha-2,8-Sialyltransferase 8B/ST8SIA2 Recombinant Protein Antigen (NBP3-17939PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional ST8 alpha-2,8-Sialyltransferase 8B/ST8SIA2 Products

Research Areas for ST8 alpha-2,8-Sialyltransferase 8B/ST8SIA2 Recombinant Protein Antigen (NBP3-17939PEP)

Find related products by research area.

Blogs on ST8 alpha-2,8-Sialyltransferase 8B/ST8SIA2

There are no specific blogs for ST8 alpha-2,8-Sialyltransferase 8B/ST8SIA2, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
TNF-alpha [Unconjugated]
210-TA-005

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our ST8 alpha-2,8-Sialyltransferase 8B/ST8SIA2 Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol ST8SIA2