![Western Blot: SRRM1 Antibody [NBP2-85821] - WB Suggested Anti-Srrm1 Antibody. Titration: 1.0 ug/ml. Positive Control: Rat Brain](http://images.novusbio.com/fullsize/SRRM1-Antibody-Western-Blot-NBP2-85821-img0002.jpg "Western Blot: SRRM1 Antibody [NBP2-85821] - WB Suggested Anti-Srrm1 Antibody. Titration: 1.0 ug/ml. Positive Control: Rat Brain")
| Reactivity | Hu, RtSpecies Glossary |
| Applications | WB, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Concentration | 0.5 mg/ml |
| Immunogen | The immunogen is a synthetic peptide directed towards the C-terminal region of SRRM1. Peptide sequence: PSPVQSQSPSTNWSPAAPAKKAKSPTPSPSPARNSDQEGGGKKKKKKKDK The peptide sequence for this immunogen was taken from within the described region. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | SRRM1 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS, 2% Sucrose |
| Preservative | 0.09% Sodium Azide |
| Concentration | 0.5 mg/ml |
| Purity | Affinity purified |
![Western Blot DEK Antibody (715524) [Unconjugated]](https://images.novusbio.com/images2/DEK_MAB7020_Western_Blot_11326.jpg)
![Immunohistochemistry DEK Antibody (715524) [Unconjugated]](https://images.novusbio.com/images2/DEK_MAB7020_Immunohistochemistry_20290.jpg)
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | SRRM1 |
![Immunohistochemistry-Paraffin: SRRM1 Antibody [NBP2-85821] - Rabbit Anti-Srrm1 antibody. Formalin Fixed Paraffin Embedded Tissue: Human Colon. Primary antibody Concentration: 1:100. Secondary Antibody: Donkey anti-Rabbit-Cy3. Secondary Antibody Concentration: 1:200. Magnification: 20x. Exposure Time: 0.5-2.0sec](http://images.novusbio.com/fullsize/SRRM1-Antibody-Immunohistochemistry-Paraffin-NBP2-85821-img0001.jpg "Immunohistochemistry-Paraffin: SRRM1 Antibody [NBP2-85821] - Rabbit Anti-Srrm1 antibody. Formalin Fixed Paraffin Embedded Tissue: Human Colon. Primary antibody Concentration: 1:100. Secondary Antibody: Donkey anti-Rabbit-Cy3. Secondary Antibody Concentration: 1:200. Magnification: 20x. Exposure Time: 0.5-2.0sec")
![Immunohistochemistry Desmoglein-1 Antibody [Unconjugated] - Propeptide](https://images.novusbio.com/images2/Desmoglein-1_AF944_Immunohistochemistry_9801.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")