![Western Blot: SRp55 Antibody (5G6) [H00006431-M02] - Analysis of SFRS6 expression in transfected 293T cell line by SFRS6 monoclonal antibody (M02), clone 5G6.Lane 1: SFRS6 transfected lysate(39.6 KDa).Lane 2: Non-transfected lysate.](http://images.novusbio.com/fullsize/SRp55-Antibody-5G6-Western-Blot-H00006431-M02-img0005.jpg "Western Blot: SRp55 Antibody (5G6) [H00006431-M02] - Analysis of SFRS6 expression in transfected 293T cell line by SFRS6 monoclonal antibody (M02), clone 5G6.Lane 1: SFRS6 transfected lysate(39.6 KDa).Lane 2: Non-transfected lysate.")
| Reactivity | HuSpecies Glossary |
| Applications | WB, ELISA, ICC/IF |
| Clone | 5G6 |
| Clonality | Monoclonal |
| Host | Mouse |
| Conjugate | Unconjugated |
| Description | Quality control test: Antibody Reactive Against Recombinant Protein. |
| Immunogen | SFRS6 (NP_006266, 1 a.a. ~ 75 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MPRVYIGRLSYNVREKDIQRFFSGYGRLLEVDLKNGYGFVEFEDSRDADDAVYELNGKELCGERVIVEHARGPRR |
| Specificity | SFRS6 - splicing factor, arginine/serine-rich 6 (5G6) |
| Isotype | IgG2b Kappa |
| Clonality | Monoclonal |
| Host | Mouse |
| Gene | SRSF6 |
| Purity | IgG purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Application Notes | Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control. |
| Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer | In 1x PBS, pH 7.4 |
| Preservative | No Preservative |
| Purity | IgG purified |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunocytochemistry/Immunofluorescence: SRp55 Antibody (5G6) [H00006431-M02] - Analysis of monoclonal antibody to SFRS6 on HeLa cell . Antibody concentration 10 ug/ml.](http://images.novusbio.com/fullsize/SRp55-Antibody-5G6-Immunocytochemistry-Immunofluorescence-H00006431-M02-img0003.jpg "Immunocytochemistry/Immunofluorescence: SRp55 Antibody (5G6) [H00006431-M02] - Analysis of monoclonal antibody to SFRS6 on HeLa cell . Antibody concentration 10 ug/ml.")
![Sandwich ELISA: SRp55 Antibody (5G6) [H00006431-M02] - Detection limit for recombinant GST tagged SFRS6 is approximately 0.3ng/ml as a capture antibody.](http://images.novusbio.com/fullsize/SRp55-Antibody-5G6-Sandwich-ELISA-H00006431-M02-img0004.jpg "Sandwich ELISA: SRp55 Antibody (5G6) [H00006431-M02] - Detection limit for recombinant GST tagged SFRS6 is approximately 0.3ng/ml as a capture antibody.")
![N/A VEGF [HRP]](https://images.novusbio.com/images2/DATA_VEGF_DVE00_ELISA_871.jpg)
![N/A VEGF [HRP]](https://images.novusbio.com/images2/DATA_VEGF_DVE00_ELISA_872.jpg)
![N/A VEGF [HRP]](https://images.novusbio.com/images2/VEGF_DVE00_ELISA_208.jpg)
![N/A Coagulation Factor III/Tissue Factor [HRP]](https://images.novusbio.com/images2/DATA_Coagulation_Factor_III_DCF300_ELISA_625.jpg)
![N/A Coagulation Factor III/Tissue Factor [HRP]](https://images.novusbio.com/images2/Coagulation_Factor_III_DCF300_ELISA_61.jpg)
