![Western Blot: Spermine synthase Antibody [NBP1-87812] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11Lane 2: Human cell line RT-4Lane 3: Human cell line U-251MG sp](http://images.novusbio.com/fullsize/Spermine-synthase-Antibody-Western-Blot-NBP1-87812-img0004.jpg "Western Blot: Spermine synthase Antibody [NBP1-87812] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11Lane 2: Human cell line RT-4Lane 3: Human cell line U-251MG sp")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, Simple Western, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: HSTLDFMLGAKADGETILKGLQSIFQEQGMAESVHTWQDHGYLATYTNKNGSFANLRIYPHGLVLLDLQSYDGDAQGKEEIDSILNKVEERMKELS |
| Predicted Species | Mouse (90%), Rat (90%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | SMS |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. Simple Western reported by internal validation: Tested in HeLa; separated by size; antibody dilution of 1:50. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Flow Cytometry ERMAP Antibody [Unconjugated]](https://images.novusbio.com/images2/ERMAP_AF4928_Flow_Cytometry_11957.jpg)
![Neutralization Prolactin Antibody [Unconjugated]](https://images.novusbio.com/images2/Prolactin_AF1445_Block_Neutralize_8779.jpg)
![Western Blot Prolactin Antibody [Unconjugated]](https://images.novusbio.com/images2/Prolactin_AF1445_Western_Blot_20179.jpg)
![Immunohistochemistry Prolactin Antibody [Unconjugated]](https://images.novusbio.com/images/antibody/af1445_mouse-rat-prolactin-affinity-purified-polyclonal-ab-immunohistochemistry-19202393922..jpg)
Secondary Antibodies |
Isotype Controls |
Research Areas for Spermine synthase Antibody (NBP1-87812)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | SMS |
![Immunocytochemistry/Immunofluorescence: Spermine synthase Antibody [NBP1-87812] - Staining of human cell line U-2 OS shows localization to nuclear bodies. Antibody staining is shown in green.](http://images.novusbio.com/fullsize/Spermine-synthase-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-87812-img0006.jpg "Immunocytochemistry/Immunofluorescence: Spermine synthase Antibody [NBP1-87812] - Staining of human cell line U-2 OS shows localization to nuclear bodies. Antibody staining is shown in green.")
![Immunohistochemistry-Paraffin: Spermine synthase Antibody [NBP1-87812] - Staining of human skin shows no positivity in squamous epithelial cells as expected.](http://images.novusbio.com/fullsize/Spermine-synthase-Antibody-Immunohistochemistry-Paraffin-NBP1-87812-img0011.jpg "Immunohistochemistry-Paraffin: Spermine synthase Antibody [NBP1-87812] - Staining of human skin shows no positivity in squamous epithelial cells as expected.")
![Immunohistochemistry-Paraffin: Spermine synthase Antibody [NBP1-87812] - Staining of human ovary shows strong cytoplasmic positivity in follicle cells.](http://images.novusbio.com/fullsize/Spermine-synthase-Antibody-Immunohistochemistry-Paraffin-NBP1-87812-img0008.jpg "Immunohistochemistry-Paraffin: Spermine synthase Antibody [NBP1-87812] - Staining of human ovary shows strong cytoplasmic positivity in follicle cells.")
![Immunohistochemistry-Paraffin: Spermine synthase Antibody [NBP1-87812] - Staining of human placenta shows strong cytoplasmic positivity in trophoblastic cells.](http://images.novusbio.com/fullsize/Spermine-synthase-Antibody-Immunohistochemistry-Paraffin-NBP1-87812-img0009.jpg "Immunohistochemistry-Paraffin: Spermine synthase Antibody [NBP1-87812] - Staining of human placenta shows strong cytoplasmic positivity in trophoblastic cells.")
![Immunohistochemistry-Paraffin: Spermine synthase Antibody [NBP1-87812] - Staining of human prostate shows moderate cytoplasmic positivity in smooth muscle cells.](http://images.novusbio.com/fullsize/Spermine-synthase-Antibody-Immunohistochemistry-Paraffin-NBP1-87812-img0010.jpg "Immunohistochemistry-Paraffin: Spermine synthase Antibody [NBP1-87812] - Staining of human prostate shows moderate cytoplasmic positivity in smooth muscle cells.")
![Western Blot Growth Hormone Antibody [Unconjugated]](https://images.novusbio.com/images2/Growth_Hormone_AF1067_Western_Blot_20961.jpg)
![ELISA Growth Hormone Antibody [Unconjugated]](https://images.novusbio.com/images2/Growth_Hormone_AF1067_ELISA_22201.jpg)
![Neutralization Growth Hormone Antibody [Unconjugated]](https://images.novusbio.com/images2/Growth_Hormone_AF1067_Block_Neutralize_8751.jpg)
![Immunocytochemistry Insulin Antibody (182410) [Unconjugated]](https://images.novusbio.com/images2/Insulin_MAB1417_Immunocytochemistry_9376.jpg)
![Immunohistochemistry Insulin Antibody (182410) [Unconjugated]](https://images.novusbio.com/images2/mab1417_human-bovine-mouse-insulin-mab-clone-182410-immunohistochemistry-308202115145.jpg)
![SDS-PAGE IGF-I/IGF-1 [Unconjugated]](https://images.novusbio.com/images2/IGF-I_291-G1_40.jpg)
![Bioactivity IGF-I/IGF-1 [Unconjugated]](https://images.novusbio.com/images2/IGF-I_291-G1_41.jpg)
![Mass Spectrometry IGF-I/IGF-1 [Unconjugated]](https://images.novusbio.com/images2/IGF-I_291-G1_42.jpg)
![Immunocytochemistry Glucagon Antibody (181402) [Unconjugated]](https://images.novusbio.com/images2/Glucagon_MAB1249_Immunocytochemistry_6560.jpg)
![Intracellular Staining by Flow Cytometry Glucagon Antibody (181402) [Unconjugated]](https://images.novusbio.com/images2/Glucagon_MAB1249_Flow_Cytometry_20264.jpg)
![Immunohistochemistry GAD1/GAD67 Antibody [Unconjugated]](https://images.novusbio.com/images2/GAD1_AF2086_Immunohistochemistry_6730.jpg)
![Western Blot GAD1/GAD67 Antibody [Unconjugated]](https://images.novusbio.com/images2/GAD1_AF2086_Western_Blot_19950.jpg)
![Simple Western GAD1/GAD67 Antibody [Unconjugated]](https://images.novusbio.com/images2/GAD1_AF2086_Simple_Western_20168.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")