![Immunocytochemistry/Immunofluorescence: SP8 Antibody [NBP2-49109] - Staining of human cell line PC-3 shows localization to nucleus. Antibody staining is shown in green.](http://images.novusbio.com/fullsize/SP8-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-49109-img0003.jpg "Immunocytochemistry/Immunofluorescence: SP8 Antibody [NBP2-49109] - Staining of human cell line PC-3 shows localization to nucleus. Antibody staining is shown in green.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: HPYESWFKPSHPGLGAAGEVGSAGASSWWDVGAGWIDVQNPNSA |
| Predicted Species | Rat (93%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | SP8 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
| Publications using NBP2-49109 | Applications | Species |
|---|---|---|
| Borrett MJ, Innes BT, Jeong D et al. Single-Cell Profiling Shows Murine Forebrain Neural Stem Cells Reacquire a Developmental State when Activated for Adult Neurogenesis Cell Rep 2020-08-11 [PMID: 32783944] (IF/IHC, Mouse) Details: Citation using the Biotin format of this antibody. |
IF/IHC | Mouse |
| Borrett MJ Single Cell Transcriptional Approaches to Understanding the Life of Mammalian Neural Stem Cells Thesis 2021-01-01 |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | SP8 |
![Immunohistochemistry-Paraffin: SP8 Antibody [NBP2-49109] - Staining of human kidney shows no positivity in cells in tubules as expected.](http://images.novusbio.com/fullsize/SP8-Antibody-Immunohistochemistry-Paraffin-NBP2-49109-img0008.jpg "Immunohistochemistry-Paraffin: SP8 Antibody [NBP2-49109] - Staining of human kidney shows no positivity in cells in tubules as expected.")
![Immunohistochemistry-Paraffin: SP8 Antibody [NBP2-49109] - Staining of human placenta shows no positivity in trophoblastic cells as expected.](http://images.novusbio.com/fullsize/SP8-Antibody-Immunohistochemistry-Paraffin-NBP2-49109-img0005.jpg "Immunohistochemistry-Paraffin: SP8 Antibody [NBP2-49109] - Staining of human placenta shows no positivity in trophoblastic cells as expected.")
![Immunohistochemistry-Paraffin: SP8 Antibody [NBP2-49109] - Staining of human prostate shows strong nuclear positivity in glandular cells.](http://images.novusbio.com/fullsize/SP8-Antibody-Immunohistochemistry-Paraffin-NBP2-49109-img0006.jpg "Immunohistochemistry-Paraffin: SP8 Antibody [NBP2-49109] - Staining of human prostate shows strong nuclear positivity in glandular cells.")
![Immunohistochemistry-Paraffin: SP8 Antibody [NBP2-49109] - Staining of human tonsil shows no positivity in non-germinal center cells as expected.](http://images.novusbio.com/fullsize/SP8-Antibody-Immunohistochemistry-Paraffin-NBP2-49109-img0007.jpg "Immunohistochemistry-Paraffin: SP8 Antibody [NBP2-49109] - Staining of human tonsil shows no positivity in non-germinal center cells as expected.")
![SDS-PAGE FGF-8 [Unconjugated]](https://images.novusbio.com/images2/FGF-8_423-F8_332.jpg)
![Bioactivity FGF-8 [Unconjugated]](https://images.novusbio.com/images2/FGF8_423F8_1438.jpg)
![Cell Culture FGF-8 [Unconjugated]](https://images.novusbio.com/images/423-f8_recombinant-human-mouse-fgf-8b-protein-cell-culture-1052024145159..jpg)
![N/A PSG1 [HRP]](https://images.novusbio.com/images2/DATA_PSG1_DPSG10_ELISA_797.jpg)
![N/A PSG1 [HRP]](https://images.novusbio.com/images2/PSG-1_DPSG10_ELISA_164.jpg)
![Immunohistochemistry TFF2 Antibody (366508) [Unconjugated]](https://images.novusbio.com/images2/TFF2_MAB4077_Immunohistochemistry_21485.jpg)
![Bioactivity Sonic Hedgehog/Shh [Unconjugated]](https://images.novusbio.com/images2/Sonic_Hedgehog_464SH_2840.jpg)
![SDS-PAGE Sonic Hedgehog/Shh [Unconjugated]](https://images.novusbio.com/images2/Sonic_Hedgehog_464-SH_341.jpg)
![SEC-MALS Sonic Hedgehog/Shh [Unconjugated]](https://images.novusbio.com/images/464-sh_recombinant-mouse-sonic-hedgehog-shh-c25ii-n-terminus-sec-mals-642023224324.jpg)
![Simple Western Pax6 Antibody [Unconjugated]](https://images.novusbio.com/images2/Pax6_AF8150_Simple_Western_17126.jpg)
![Immunocytochemistry Pax6 Antibody [Unconjugated]](https://images.novusbio.com/images2/Pax6_AF8150_Immunocytochemistry_14427.jpg)
![Western Blot Pax6 Antibody [Unconjugated]](https://images.novusbio.com/images2/Pax6_AF8150_Western_Blot_14743.jpg)
![Western Blot EMX2 Antibody [Unconjugated]](https://images.novusbio.com/images2/EMX2_AF6470_Western_Blot_10298.jpg)
![Immunocytochemistry EMX2 Antibody [Unconjugated]](https://images.novusbio.com/images/antibody/af6470_human-mouse-emx2-affinity-purified-polyclonal-ab-immunocytochemistry-241202491313..jpg)
![SDS-PAGE BMP-4 [Unconjugated]](https://images.novusbio.com/images2/BMP-4_314-BP_100.jpg)
![Bioactivity BMP-4 [Unconjugated]](https://images.novusbio.com/images2/314-bp_recombinant-human-bmp-4-protein-1882021123744.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")