![Western Blot: SOX9 Antibody (CL0639) [NBP2-52943] - 251 Cells transfected with: control siRNA, target specific siRNA probe #1, target specific siRNA probe #2, using Anti-SOX9 monoclonal antibody. Downregulation of antibody signal confirms target specificity. Remaining % intensity, relative control lane, is indicated. Anti-GAPDH monoclonal antibody was used as loading control.](http://images.novusbio.com/fullsize/SOX9-Antibody-CL0639-Western-Blot-NBP2-52943-img0011.jpg "Western Blot: SOX9 Antibody (CL0639) [NBP2-52943] - 251 Cells transfected with: control siRNA, target specific siRNA probe #1, target specific siRNA probe #2, using Anti-SOX9 monoclonal antibody. Downregulation of antibody signal confirms target specificity. Remaining % intensity, relative control lane, is indicated. Anti-GAPDH monoclonal antibody was used as loading control.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, ICC/IF, IHC, KD |
| Clone | CL0639 |
| Clonality | Monoclonal |
| Host | Mouse |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: SQRTHIKTEQLSPSHYSEQQQHSPQQIAYSPFNLPHYSPSYPPITRSQYDYTDHQNSSSYYSHAAGQGTGLYSTFTYMNPAQRPMYTPIADTSGVPSIPQTHSPQHWEQPVYTQLTR |
| Epitope | SQRTHIKTEQLSPSH |
| Predicted Species | Rat (96%). Backed by our 100% Guarantee. |
| Isotype | IgG2a |
| Clonality | Monoclonal |
| Host | Mouse |
| Gene | SOX9 |
| Purity | Protein A purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Protein A purified |
| Publication using NBP2-52943 | Applications | Species |
|---|---|---|
| Holokai L, Chakrabarti J, Lundy J et al. Murine- and Human-Derived Autologous Organoid/Immune Cell Co-Cultures as Pre-Clinical Models of Pancreatic Ductal Adenocarcinoma Cancers 2020-12-17 [PMID: 33348809] (ICC/IF, Human) | ICC/IF | Human |
Secondary Antibodies |
Isotype Controls |
Research Areas for SOX9 Antibody (NBP2-52943)Find related products by research area.
|
|
Role of GFAP in astrocytes: Lessons from induced pluripotent stem cells in Alexander disease patients By Michalina Hanzel, PhDAlexander disease is a progressive and fatal neurological disease with phenotypes ranging from myelination abnormalities, gait ataxia and megalencephaly to predisposition to seizures. It is an ... Read full blog post. |
|
Deriving neural precursor cells from human induced pluripotent stem cells By Jennifer Sokolowski, MD, PhD.Human induced pluripotent stem cells (iPSCs) can be used to create models of human organ systems and are useful for a) ascertaining the mechanisms underlying pathological conditions... Read full blog post. |
|
The use of a GFP antibody for research applications in transgenic C. elegans, GFP tagged yeast and porcine model GFP, or green fluorescent protein, is a chemiluminescent protein derived from Aequorea jellyfish that was first discovered by Osamu Shimomura. It was soon after established that the emission spectra of GFP was right around 509nm, or the ultraviol... Read full blog post. |
|
SOX9 - Be careful, I can reverse your gender! SOX9 is a member of the SOX family of HMG DNA-binding domain transcription factors. The protein encoded by this gene recognizes the sequence CCTTGAG along with other members of the HMG-box class DNA-binding proteins. cAMP and protein kinase A (PKA) st... Read full blog post. |
|
Using the Hif-1 Alpha Antibody in Prostate Cancer Research The Hypoxia-inducible Factor 1 (HIF1) protein is a heterodimeric transcription factor which plays an important role in mammalian oxygen homeostasis in conditions of hypoxia, or low oxygen concentration. HIF-1 alpha antibody reagents are widely used in... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | SOX9 |
![Immunohistochemistry-Paraffin: SOX9 Antibody (CL0639) [NBP2-52943] - Analysis in human cerebral cortex and liver tissues using NBP2-52943antibody. Corresponding SOX9 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/SOX9-Antibody-CL0639-Immunohistochemistry-Paraffin-NBP2-52943-img0018.jpg "Immunohistochemistry-Paraffin: SOX9 Antibody (CL0639) [NBP2-52943] - Analysis in human cerebral cortex and liver tissues using NBP2-52943antibody. Corresponding SOX9 RNA-seq data are presented for the same tissues.")
![Immunocytochemistry/Immunofluorescence: SOX9 Antibody (CL0639) [NBP2-52943] - Staining of U-251 cells using the anti-SOX9 monoclonal antibody, showing specific staining in the nucleoplasm in green. Microtubule- and nuclear probes are visualized in red and blue, respectively (where available). Antibody staining is shown in green.](http://images.novusbio.com/fullsize/SOX9-Antibody-CL0639-Immunocytochemistry-Immunofluorescence-NBP2-52943-img0016.jpg "Immunocytochemistry/Immunofluorescence: SOX9 Antibody (CL0639) [NBP2-52943] - Staining of U-251 cells using the anti-SOX9 monoclonal antibody, showing specific staining in the nucleoplasm in green. Microtubule- and nuclear probes are visualized in red and blue, respectively (where available). Antibody staining is shown in green.")
![Immunohistochemistry-Paraffin: SOX9 Antibody (CL0639) [NBP2-52943] - Staining of human liver shows no nuclear positivity in hepatocytes as expected.](http://images.novusbio.com/fullsize/SOX9-Antibody-CL0639-Immunohistochemistry-Paraffin-NBP2-52943-img0021.jpg "Immunohistochemistry-Paraffin: SOX9 Antibody (CL0639) [NBP2-52943] - Staining of human liver shows no nuclear positivity in hepatocytes as expected.")
![Immunohistochemistry: SOX9 Antibody (CL0639) [NBP2-52943] - Staining of mouse embryo E11 shows nuclear positivity in the developing neural tube.](http://images.novusbio.com/fullsize/SOX9-Antibody-CL0639-Immunohistochemistry-NBP2-52943-img0013.jpg "Immunohistochemistry: SOX9 Antibody (CL0639) [NBP2-52943] - Staining of mouse embryo E11 shows nuclear positivity in the developing neural tube.")
![Immunohistochemistry: SOX9 Antibody (CL0639) [NBP2-52943] - Staining of mouse embryo E14 shows nuclear immunoreactivity in the developing eye.](http://images.novusbio.com/fullsize/SOX9-Antibody-CL0639-Immunohistochemistry-NBP2-52943-img0014.jpg "Immunohistochemistry: SOX9 Antibody (CL0639) [NBP2-52943] - Staining of mouse embryo E14 shows nuclear immunoreactivity in the developing eye.")
![Immunohistochemistry-Paraffin: SOX9 Antibody (CL0639) [NBP2-52943] - Staining of human cerebral cortex shows moderate to strong nuclear positivity in a subset of glial cells.](http://images.novusbio.com/fullsize/SOX9-Antibody-CL0639-Immunohistochemistry-Paraffin-NBP2-52943-img0019.jpg "Immunohistochemistry-Paraffin: SOX9 Antibody (CL0639) [NBP2-52943] - Staining of human cerebral cortex shows moderate to strong nuclear positivity in a subset of glial cells.")
![Immunohistochemistry-Paraffin: SOX9 Antibody (CL0639) [NBP2-52943] - Staining of human testis shows strong nuclear positivity in a subset of cells in seminiferious ducts.](http://images.novusbio.com/fullsize/SOX9-Antibody-CL0639-Immunohistochemistry-Paraffin-NBP2-52943-img0020.jpg "Immunohistochemistry-Paraffin: SOX9 Antibody (CL0639) [NBP2-52943] - Staining of human testis shows strong nuclear positivity in a subset of cells in seminiferious ducts.")
![Immunocytochemistry RUNX2/CBFA1 Antibody (232902) [Unconjugated]](https://images.novusbio.com/images2/RUNX2_MAB2006_Immunocytochemistry_13309.jpg)
![Immunohistochemistry RUNX2/CBFA1 Antibody (232902) [Unconjugated]](https://images.novusbio.com/images/mab2006_human-runx2-cbfa1-mab-clone-232902-812025555286.jpg)
![Bioactivity BMP-2 [Unconjugated]](https://images.novusbio.com/images/protein/355-bm_recombinant-human-mouse-rat-bmp-2-protein-bioactivity-181120209742.jpg)
![Immunocytochemistry SOX10 Antibody [Unconjugated]](https://images.novusbio.com/images2/SOX10_AF2864_Immunocytochemistry__Immunofluorescence_17799.jpg)
![Immunocytochemistry SOX10 Antibody [Unconjugated]](https://images.novusbio.com/images2/af2864_human-sox10-affinity-purified-polyclonal-ab-immunocytochemistry-3032021155556.jpg)
![Immunohistochemistry SOX10 Antibody [Unconjugated]](https://images.novusbio.com/images2/af2864_human-sox10-affinity-purified-polyclonal-ab-immunohistochemistry-303202115544.jpg)
![Western Blot ERK2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ERK2_AF1230_Western_Blot_5097.jpg)
![Immunohistochemistry ERK2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ERK2_AF1230_Immunohistochemistry_20696.jpg)
![Knockout Validated ERK2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ERK2_AF1230_Knockout_Validated_22864.jpg)
![SDS-PAGE IGF-I/IGF-1 [Unconjugated]](https://images.novusbio.com/images2/IGF-I_291-G1_40.jpg)
![Bioactivity IGF-I/IGF-1 [Unconjugated]](https://images.novusbio.com/images2/IGF-I_291-G1_41.jpg)
![Mass Spectrometry IGF-I/IGF-1 [Unconjugated]](https://images.novusbio.com/images2/IGF-I_291-G1_42.jpg)
![SDS-PAGE BMP-4 [Unconjugated]](https://images.novusbio.com/images2/BMP-4_314-BP_100.jpg)
![Bioactivity BMP-4 [Unconjugated]](https://images.novusbio.com/images2/314-bp_recombinant-human-bmp-4-protein-1882021123744.jpg)
