Home » SMAC/Diablo » SMAC/Diablo Proteins » SMAC/Diablo Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

SMAC/Diablo Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for SMAC/Diablo Protein (NBP1-84262PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

SMAC/Diablo Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human DIABLO.

Source: E. coli

Amino Acid Sequence: AVYTLTSLYRQYTSLLGKMNSEEEDEVWQVIIGARAEMTSKHQEYLKLETTWMTAVGLSEMAAEAAYQTGADQASITARNHIQLVKLQVEEVHQLSRKAETKLAEAQIEELRQKTQEEG

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
DIABLO
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-84262.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
31 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for SMAC/Diablo Recombinant Protein Antigen

  • 0610041G12Rik
  • Diablo
  • diablo, IAP-binding mitochondrial protein
  • Direct IAP-binding protein with low pI
  • mitochondrial Smac protein
  • Second mitochondria-derived activator of caspase
  • SMAC
  • SMACmitochondrial

Background

Smac/DIABLO is a mitochondrial protein which activates various forms of apoptosis. Specifically, Smac exits the mitochondria and enters the cytosol where it initiates apoptosis by neutralizing members of the IAP family of apoptosis inhibitory proteins. Mitochondrial-mediated apoptosis is important in animal development and tissue homeostasis, with alterations resulting in a range of malignant disorders. Upon apoptotic stimuli, the mitochondrial proteins cytochrome c and Smac/DIABLO are released into the cytosol. The release of these proteins, however, occurs via different mechanisms.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

XIAP Antibody
[Unconjugated]
AF8221
Western Blot XIAP Antibody [Unconjugated]
Simple Western XIAP Antibody [Unconjugated]
Knockout Validated XIAP Antibody [Unconjugated]
(23 Publications)
Species: Hu, Mu, Rt
Applications: IHC, KO, Simple Western, WB
Cytochrome c
Antibody (7H8.2C12) - ...
NB100-56503
Flow Cytometry Cytochrome c Antibody (7H8.2C12) - BSA Free
Flow (Intracellular) Cytochrome c Antibody (7H8.2C12) - BSA Free
Western Blot Cytochrome c Antibody (7H8.2C12) - BSA Free
(61 Publications)
Species: Dr, Hu, Mu, Rb, Rt
Applications: Flow-CS, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-P, Simple Western, WB
Caspase-3 Antibody
[Unconjugated] - Acti ...
AF835
Immunocytochemistry Caspase-3 Antibody [Unconjugated] - Active
Immunohistochemistry Caspase-3 Antibody [Unconjugated] - Active
Immunocytochemistry Caspase-3 Antibody [Unconjugated] - Active
(7 Reviews)
(389 Publications)
Species: Hu, Mu
Applications: ICC, IHC
Caspase-9 Antibody
NB100-56118
Immunohistochemistry Caspase-9 Antibody
Immunohistochemistry Caspase-9 Antibody
Immunohistochemistry Caspase-9 Antibody
(1 Review)
(28 Publications)
Species: Ca, Ma, Hu, Mu, Rt
Applications: Flow-IC, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Bax Antibody (6A7)
NBP1-28566
Western Blot Bax Antibody (6A7)
Western Blot Bax Antibody (6A7)
Immunohistochemistry-Frozen Bax Antibody (6A7)
(3 Reviews)
(21 Publications)
Species: Bv, Hu, Pm, Mu, Po, Rt
Applications: Func, IHC, IHC-Fr, IHC-P, WB
Bcl-2 Antibody
NB100-56098
Western Blot Bcl-2 Antibody
Western Blot Bcl-2 Antibody
Western Blot Bcl-2 Antibody
(2 Reviews)
(26 Publications)
Species: Ca, Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
HTRA2/Omi Antibody
[Unconjugated]
AF1458
Western Blot HTRA2/Omi Antibody [Unconjugated]
Simple Western HTRA2/Omi Antibody [Unconjugated]
Immunocytochemistry HTRA2/Omi Antibody [Unconjugated]
(3 Reviews)
(33 Publications)
Species: Hu, Mu, Rt
Applications: ICC, Simple Western, WB
Caspase-8 Antibody
NB100-56116
Western Blot Caspase-8 Antibody
Immunohistochemistry-Paraffin Caspase-8 Antibody
Immunohistochemistry-Paraffin Caspase-8 Antibody
(2 Reviews)
(79 Publications)
Species: Ma, Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Simple Western, WB
TRAIL/TNFSF10
[Unconjugated]
375-TL
TRAIL/TNFSF10 [Unconjugated]
(1 Review)
(54 Publications)
Species: Hu
Applications: BA
TNF-alpha
[Unconjugated]
210-TA
SDS-PAGE TNF-alpha [Unconjugated]
Bioactivity TNF-alpha [Unconjugated]
SEC-MALS TNF-alpha [Unconjugated]
(3 Reviews)
(818 Publications)
Species: Hu
Applications: BA
BID Antibody
[Unconjugated]
AF860
Simple Western BID Antibody [Unconjugated]
Western Blot BID Antibody [Unconjugated]
Western Blot BID Antibody [Unconjugated]
(1 Review)
(39 Publications)
Species: Hu, Mu
Applications: IP, Simple Western, WB
Bcl-xL Antibody
NB100-56104
Western Blot Bcl-xL Antibody
Immunohistochemistry-Paraffin Bcl-xL Antibody
Western Blot Bcl-xL Antibody
(1 Review)
(3 Publications)
Species: Ca, Hu, Mu, Rt
Applications: IHC, IHC-Fr, IHC-P, IP, WB
CD47 Antibody
[Unconjugated]
AF4670
Western Blot CD47 Antibody [Unconjugated]
Neutralization CD47 Antibody [Unconjugated]
Immunohistochemistry CD47 Antibody [Unconjugated]
(4 Reviews)
(14 Publications)
Species: Hu
Applications: CyTOF-ready, Flow, IHC, KO, Neut, WB
Alkaline
Phosphatase, Intestin ...
NBP3-25355
Western Blot Alkaline Phosphatase, Intestinal Antibody (HL1268) - Azide and BSA Free
Immunohistochemistry-Paraffin Alkaline Phosphatase, Intestinal Antibody (HL1268) - Azide and BSA Free
Western Blot Alkaline Phosphatase, Intestinal Antibody (HL1268) - Azide and BSA Free
Species: Dr, Hu, Mu
Applications: IHC, IHC-P, WB
Amylin Antibody
NBP2-33680
Immunohistochemistry Amylin Antibody
Immunohistochemistry-Paraffin Amylin Antibody
Immunohistochemistry-Paraffin Amylin Antibody
Species: Hu
Applications: IHC, IHC-P
MAGT1 Antibody
NBP2-14214
Immunohistochemistry-Paraffin MAGT1 Antibody
Immunohistochemistry-Paraffin MAGT1 Antibody
Immunohistochemistry-Paraffin MAGT1 Antibody
Species: Hu
Applications: IHC, IHC-P
AIF Antibody
[Unconjugated]
AF1457
Western Blot AIF Antibody [Unconjugated]
Simple Western AIF Antibody [Unconjugated]
Knockout Validated AIF Antibody [Unconjugated]
(6 Publications)
Species: Hu, Mu, Rt
Applications: ICC, KO, Simple Western, WB
SMAC/Diablo
Recombinant Protein A
NBP1-84262PEP
SMAC/Diablo Recombinant Protein Antigen
Species: Hu
Applications: AC

Publications for SMAC/Diablo Protein (NBP1-84262PEP) (0)

There are no publications for SMAC/Diablo Protein (NBP1-84262PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SMAC/Diablo Protein (NBP1-84262PEP) (0)

There are no reviews for SMAC/Diablo Protein (NBP1-84262PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for SMAC/Diablo Protein (NBP1-84262PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional SMAC/Diablo Products

Research Areas for SMAC/Diablo Protein (NBP1-84262PEP)

Find related products by research area.

Blogs on SMAC/Diablo.

Check out the latest blog posts on SMAC/Diablo.
Apoptosis and Necroptosis Part II: Inhibitors of apoptosis proteins (IAPs); Key regulators of the balance between necroptosis, apoptosis and survival
In the first installment of this two-part blog post titled "Apoptosis and Necroptosis: Important factors to identify both types of programmed cell death", the mechanisms by which cell death occurs and ways to identify these pathways were ...  Read full blog post.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
TNF-alpha [Unconjugated]
210-TA-005
Caspase‑3 was detected in immersion fixed anti-FAS treated Jurkat human acute T cell leukemia cell line using 0.3 µg/mL Human/Mouse Active Caspase‑3 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF835) for 3 hours at room temperature. Cells were stained (red) and counterstained (green). View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
Caspase-3 Antibody [Unconjugated] - Active
AF835

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our SMAC/Diablo Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol DIABLO