![Immunohistochemistry-Paraffin: SLCO2A1 Antibody [NBP2-13349] - Staining in human seminal vesicle and skeletal muscle tissues . Corresponding SLCO2A1 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/SLCO2A1-Antibody-Immunohistochemistry-Paraffin-NBP2-13349-img0012.jpg "Immunohistochemistry-Paraffin: SLCO2A1 Antibody [NBP2-13349] - Staining in human seminal vesicle and skeletal muscle tissues . Corresponding SLCO2A1 RNA-seq data are presented for the same tissues.")
| Reactivity | HuSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against a recombinant protein corresponding to the amino acids: PSTSSSIHPQSPACRRDCSCPDSIFHPVCGDNGIEYLSPCHAGCSNINMSSATSKQLIYLNCSCVTGGSASAKTGSCPVPCAH |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | SLCO2A1 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. WB reactivity reported in (PMID:26415544). ICC/IF and IHC reactivity reported in (PMID: 26539716). |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | SLCO2A1 |
![Immunohistochemistry-Paraffin: SLCO2A1 Antibody [NBP2-13349] - Immunohistochemical staining of human prostate shows strong membranous positivity in endothelial cells.](http://images.novusbio.com/fullsize/SLCO2A1-Antibody-Immunohistochemistry-Paraffin-NBP2-13349-img0005.jpg "Immunohistochemistry-Paraffin: SLCO2A1 Antibody [NBP2-13349] - Immunohistochemical staining of human prostate shows strong membranous positivity in endothelial cells.")
![Immunohistochemistry-Paraffin: SLCO2A1 Antibody [NBP2-13349] - Immunohistochemical staining of human seminal vesicle shows strong membranous positivity in glandular cells.](http://images.novusbio.com/fullsize/SLCO2A1-Antibody-Immunohistochemistry-Paraffin-NBP2-13349-img0006.jpg "Immunohistochemistry-Paraffin: SLCO2A1 Antibody [NBP2-13349] - Immunohistochemical staining of human seminal vesicle shows strong membranous positivity in glandular cells.")
![Immunohistochemistry-Paraffin: SLCO2A1 Antibody [NBP2-13349] - Immunohistochemical staining of human kidney shows strong membranous positivity in cells in glomeruli and endothelial cells.](http://images.novusbio.com/fullsize/SLCO2A1-Antibody-Immunohistochemistry-Paraffin-NBP2-13349-img0007.jpg "Immunohistochemistry-Paraffin: SLCO2A1 Antibody [NBP2-13349] - Immunohistochemical staining of human kidney shows strong membranous positivity in cells in glomeruli and endothelial cells.")
![Immunohistochemistry-Paraffin: SLCO2A1 Antibody [NBP2-13349] - Immunohistochemical staining of human skeletal muscle shows no positivity as expected.](http://images.novusbio.com/fullsize/SLCO2A1-Antibody-Immunohistochemistry-Paraffin-NBP2-13349-img0008.jpg "Immunohistochemistry-Paraffin: SLCO2A1 Antibody [NBP2-13349] - Immunohistochemical staining of human skeletal muscle shows no positivity as expected.")
![Immunohistochemistry-Paraffin: SLCO2A1 Antibody [NBP2-13349] - Immunohistochemical staining of human lung shows strong membranous positivity in endothelial cells.](http://images.novusbio.com/fullsize/SLCO2A1-Antibody-Immunohistochemistry-Paraffin-NBP2-13349-img0009.jpg "Immunohistochemistry-Paraffin: SLCO2A1 Antibody [NBP2-13349] - Immunohistochemical staining of human lung shows strong membranous positivity in endothelial cells.")
![N/A PLGF [HRP]](https://images.novusbio.com/images2/PlGF_DPG00_ELISA_158.jpg)
![N/A PLGF [HRP]](https://images.novusbio.com/images2/DATA_PlGF_DPG00_ELISA_788.jpg)
![N/A PLGF [HRP]](https://images.novusbio.com/images2/DATA_PlGF_DPG00_ELISA_789.jpg)
![Western Blot Butyrylcholinesterase/BCHE Antibody [Unconjugated]](https://images.novusbio.com/images2/Butyrylcholinesterase_AF9024_Western_Blot_19121.jpg)
![Immunohistochemistry Butyrylcholinesterase/BCHE Antibody [Unconjugated]](https://images.novusbio.com/images2/Butyrylcholinesterase_AF9024_Immunohistochemistry_19158.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")