![Western Blot: Sin1/MAPKAP1 Antibody [NBP1-89569] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).](http://images.novusbio.com/fullsize/Sin1-MAPKAP1-Antibody-Western-Blot-NBP1-89569-img0004.jpg "Western Blot: Sin1/MAPKAP1 Antibody [NBP1-89569] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: NPFNEYSKFDGKGHVGTTATKKIDVYLPLHSSQDRLLPMTVVTMASARVQDLIGLICWQYTSEGREPKLNDNVSAYCLHIAEDDGEVDTDFPPLDSNEPIHKFGFSTLALVEKYSSPGLTSKESLFVRINAAHGFSLIQVDNTKVTMKE |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | MAPKAP1 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Western Blot AKT [p Ser473] Antibody [Unconjugated] - Pan Specific](https://images.novusbio.com/images2/Akt3_AF887_Western_Blot_5930.jpg)
![Simple Western AKT [p Ser473] Antibody [Unconjugated] - Pan Specific](https://images.novusbio.com/images2/16332.jpg)
![Intracellular Staining by Flow Cytometry AKT [p Ser473] Antibody [Unconjugated] - Pan Specific](https://images.novusbio.com/images2/Akt3_AF887_Flow_Cytometry_8283.jpg)
| Publication using NBP1-89569 | Applications | Species |
|---|---|---|
| Hau AM, Gupta S, Leivo MZ, et al. Dynamic Regulation of Caveolin-1 Phosphorylation and Caveolae Formation by mTORC2 in Bladder Cancer Cells Am. J. Pathol. 2019-06-11 [PMID: 31199921] |
Secondary Antibodies |
Isotype Controls |
Research Areas for Sin1/MAPKAP1 Antibody (NBP1-89569)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | MAPKAP1 |
![Immunohistochemistry-Paraffin: Sin1/MAPKAP1 Antibody [NBP1-89569] - Staining of human testis shows high expression.](http://images.novusbio.com/fullsize/Sin1-MAPKAP1-Antibody-Immunohistochemistry-Paraffin-NBP1-89569-img0008.jpg "Immunohistochemistry-Paraffin: Sin1/MAPKAP1 Antibody [NBP1-89569] - Staining of human testis shows high expression.")
![Immunohistochemistry-Paraffin: Sin1/MAPKAP1 Antibody [NBP1-89569] - Staining of human tonsil shows strong cytoplasmic positivity in non-germinal center cells.](http://images.novusbio.com/fullsize/Sin1-MAPKAP1-Antibody-Immunohistochemistry-Paraffin-NBP1-89569-img0006.jpg "Immunohistochemistry-Paraffin: Sin1/MAPKAP1 Antibody [NBP1-89569] - Staining of human tonsil shows strong cytoplasmic positivity in non-germinal center cells.")
![Immunohistochemistry-Paraffin: Sin1/MAPKAP1 Antibody [NBP1-89569] - Staining of human pancreas shows low expression as expected.](http://images.novusbio.com/fullsize/Sin1-MAPKAP1-Antibody-Immunohistochemistry-Paraffin-NBP1-89569-img0007.jpg "Immunohistochemistry-Paraffin: Sin1/MAPKAP1 Antibody [NBP1-89569] - Staining of human pancreas shows low expression as expected.")
![Immunohistochemistry-Paraffin: Sin1/MAPKAP1 Antibody [NBP1-89569] - Staining in human testis and pancreas tissues using anti-MAPKAP1 antibody. Corresponding MAPKAP1 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/Sin1-MAPKAP1-Antibody-Immunohistochemistry-Paraffin-NBP1-89569-img0009.jpg "Immunohistochemistry-Paraffin: Sin1/MAPKAP1 Antibody [NBP1-89569] - Staining in human testis and pancreas tissues using anti-MAPKAP1 antibody. Corresponding MAPKAP1 RNA-seq data are presented for the same tissues.")
![Immunohistochemistry-Paraffin TOR/mTOR [p Ser2448] Antibody](https://images.novusbio.com/images/TOR-mTOR-[p-Ser2448]-Antibody-Immunohistochemistry-Paraffin-NB600-607-img0005.jpg)
![Western Blot TOR/mTOR [p Ser2448] Antibody](https://images.novusbio.com/images/TOR-mTOR-[p-Ser2448]-Antibody-Western-Blot-NB600-607-img0006.jpg)
![Data TOR/mTOR [p Ser2448] Antibody](https://images.novusbio.com/images/TOR-mTOR-[p-Ser2448]-Antibody-N-A-NB600-607-img0008.jpg)
![Western Blot GBL Antibody [Unconjugated]](https://images.novusbio.com/images2/GBL_AF4004_Western_Blot_5381.jpg)
![Immunohistochemistry GBL Antibody [Unconjugated]](https://images.novusbio.com/images2/GBL_AF4004_Immunohistochemistry_19617.jpg)
![Simple Western PYK2/FAK2 [p Tyr402] Antibody (592918) [Unconjugated]](https://images.novusbio.com/images2/PYK2_MAB6210_Simple_Western_16639.jpg)
![Western Blot PYK2/FAK2 [p Tyr402] Antibody (592918) [Unconjugated]](https://images.novusbio.com/images2/PYK2_MAB6210_Western_Blot_9430.jpg)
![N/A CCL5/RANTES [HRP]](https://images.novusbio.com/images2/CCL5_DRN00_ELISA_393.jpg)
![N/A CCL5/RANTES [HRP]](https://images.novusbio.com/images2/DATA_CCL5_DRN00_ELISA_810.jpg)
![N/A CCL5/RANTES [HRP]](https://images.novusbio.com/images2/DATA_CCL5_DRN00_ELISA_811.jpg)
![N/A CCL2/JE/MCP-1 [HRP]](https://images.novusbio.com/images2/CCL2_DCP00_ELISA_67.jpg)
![N/A CCL2/JE/MCP-1 [HRP]](https://images.novusbio.com/images2/DATA_CCL2_DCP00_ELISA_633.jpg)
![N/A CCL2/JE/MCP-1 [HRP]](https://images.novusbio.com/images2/DATA_CCL2_DCP00_ELISA_634.jpg)
![N/A IL-6 [HRP]](https://images.novusbio.com/images2/DATA_IL6_M6000_ELISA_936.jpg)
![N/A IL-6 [HRP]](https://images.novusbio.com/images2/IL-6_M6000_ELISA_415.jpg)
![N/A IL-6 [HRP]](https://images.novusbio.com/images/m6000b_mouse-il-6-quantikine-elisa-kit-44202415433118.jpg)
![SDS-PAGE TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNF-alpha_210-TA_256.jpg)
![Bioactivity TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNFalpha_210TA_1658.jpg)
![SEC-MALS TNF-alpha [Unconjugated]](https://images.novusbio.com/images/210-ta_recombinant-human-tnf-alpha-protein-sec-mals-35202312244..jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")