Home » SH3PX1 » SH3PX1 Proteins » SH3PX1 Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

SH3PX1 Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for SH3PX1 Protein (NBP1-80777PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

SH3PX1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human SNX9.

Source: E. coli

Amino Acid Sequence: YQGPATGDDDDWDEDWDGPKSSSYFKDSESADAGGAQRGNSRASSSSMKIPLNKFPGFAKPGTEQYLLAKQLAKPKEKIPIIVGDYGPMW

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
SNX9
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-80777.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for SH3PX1 Recombinant Protein Antigen

  • MST155
  • MSTP155
  • Protein SDP1
  • SDP1
  • SH3 and PX domain-containing protein 1
  • SH3PX1WISP
  • SH3PXD3ASH3 and PX domain-containing protein SH3PX1
  • sorting nexin 9
  • sorting nexin-9
  • WiskSH3 and PX domain-containing protein 3A

Background

The SH3PX1 (SNX1) gene is part of the sorting nexin family, thus plays a role in several states of intracellular trafficking. There is only one isoform at 595 amino acids long and at a mass of around 66 kDA. The SH3PX1 gene has been linked to choanal atresia, alcoholism, asthma, rabies, neuronitis, and wiskitt-aldrich syndrome. It is involved in clathrin derived and trans-Golgi network vesicle budding as well as membrane trafficking through interactions with other genes such as ITCH, DNM2, SYNJ1, ASAP1, and ADAM15.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

Dynamin 2 Antibody
NBP2-47477
Immunocytochemistry/ Immunofluorescence Dynamin 2 Antibody
Immunohistochemistry-Paraffin Dynamin 2 Antibody
Immunohistochemistry-Paraffin Dynamin 2 Antibody
(3 Publications)
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KO, WB
Src [p Tyr419]
Antibody [Unconjugate
AF2685
Western Blot Src [p Tyr419] Antibody [Unconjugated]
Simple Western Src [p Tyr419] Antibody [Unconjugated]
Immunohistochemistry Src [p Tyr419] Antibody [Unconjugated]
(1 Review)
(10 Publications)
Species: Hu
Applications: IHC, Simple Western, WB
WASP Antibody
NB300-996
Immunohistochemistry-Paraffin WASP Antibody
Immunocytochemistry/ Immunofluorescence WASP Antibody
Immunocytochemistry/ Immunofluorescence WASP Antibody
(1 Publication)
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA, WB
N-WASP Antibody
NBP1-82512
Immunocytochemistry/ Immunofluorescence N-WASP Antibody
Immunohistochemistry-Paraffin N-WASP Antibody
Immunohistochemistry-Paraffin N-WASP Antibody
(7 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, Simple Western, WB
beta-2 Adrenergic
R/ADRB2 Antibody (JM1 ...
NBP2-67187
Immunohistochemistry-Paraffin beta-2 Adrenergic R/ADRB2 Antibody (JM102-06)
Immunohistochemistry-Paraffin beta-2 Adrenergic R/ADRB2 Antibody (JM102-06)
Western Blot beta-2 Adrenergic R/ADRB2 Antibody (JM102-06)
Species: Hu, Mu, Rt, Ze
Applications: ICC/IF, IHC, IHC-P, IP, WB
FXR/NR1H4 Antibody
(A9033A) [Unconjugate ...
PP-A9033A-00
FXR/NR1H4 Antibody (A9033A) [Unconjugated]
(2 Reviews)
(14 Publications)
Species: Hu
Applications: DirELISA, IHC, IP, WB
BFAR Antibody
NB100-56094
Western Blot BFAR Antibody
Immunohistochemistry-Paraffin BFAR Antibody
Immunohistochemistry-Paraffin BFAR Antibody
(1 Publication)
Species: Hu
Applications: IHC, IHC-P, IP, WB
ACK1 Antibody
H00010188-D01P
Immunocytochemistry/ Immunofluorescence ACK1 Antibody
Western Blot ACK1 Antibody
Western Blot ACK1 Antibody
Species: Hu
Applications: ICC/IF, WB
EGF [Unconjugated]
236-EG
SDS-PAGE EGF [Unconjugated]
Bioactivity EGF [Unconjugated]
Cell Culture EGF [Unconjugated]
(848 Publications)
Species: Hu
Applications: BA
SNX33 Antibody
H00257364-D01P
Western Blot SNX33 Antibody
(2 Publications)
Species: Hu
Applications: ICC/IF, WB
WISP-1/CCN4
Antibody
AF1680
Immunohistochemistry WISP-1/CCN4 Antibody
(3 Publications)
Species: Mu
Applications: IHC, WB
WISP2 Antibody -
Azide and BSA Free
NBP2-93612
Immunohistochemistry-Paraffin WISP2 Antibody - Azide and BSA Free
Immunohistochemistry-Paraffin WISP2 Antibody - Azide and BSA Free
Western Blot WISP2 Antibody - Azide and BSA Free
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Holo-Transferrin
[Unconjugated]
2914-HT
Holo-Transferrin [Unconjugated]
(51 Publications)
Species: Hu
Applications: BA
Amphiphysin/AMPH
Antibody
NBP1-87561
Immunohistochemistry-Paraffin Amphiphysin/AMPH Antibody
Immunohistochemistry-Paraffin Amphiphysin/AMPH Antibody
Immunohistochemistry-Paraffin Amphiphysin/AMPH Antibody
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
c-jun [p Ser63]
Antibody (1018Y) [Unc ...
MAB8930
Western Blot c-jun [p Ser63] Antibody (1018Y) [Unconjugated]
Immunocytochemistry c-jun [p Ser63] Antibody (1018Y) [Unconjugated]
Simple Western c-jun [p Ser63] Antibody (1018Y) [Unconjugated]
(1 Review)
(3 Publications)
Species: Hu
Applications: ICC, Simple Western, WB
Exosome component
10 Antibody
NBP1-32870
Western Blot Exosome component 10 Antibody
Immunohistochemistry-Paraffin Exosome component 10 Antibody
Western Blot Exosome component 10 Antibody
(2 Reviews)
(3 Publications)
Species: Hu
Applications: IHC, IHC-P, IP, KD, WB
AP2 alpha Antibody
(3B5)
NB100-74359
Western Blot AP2 alpha Antibody (3B5)
Immunohistochemistry-Frozen AP2 alpha Antibody (3B5)
Western Blot AP2 alpha Antibody (3B5)
(1 Review)
(3 Publications)
Species: Ch, Hu, Mu
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
ACTR2 Antibody
(1B10-C4)
H00010097-M01
Western Blot ACTR2 Antibody (1B10-C4)
Immunohistochemistry-Paraffin ACTR2 Antibody (1B10-C4)
Sandwich ELISA ACTR2 Antibody (1B10-C4)
Species: Hu
Applications: ELISA, IHC, IHC-P, S-ELISA, WB

Publications for SH3PX1 Protein (NBP1-80777PEP) (0)

There are no publications for SH3PX1 Protein (NBP1-80777PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SH3PX1 Protein (NBP1-80777PEP) (0)

There are no reviews for SH3PX1 Protein (NBP1-80777PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for SH3PX1 Protein (NBP1-80777PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional SH3PX1 Products

Blogs on SH3PX1

There are no specific blogs for SH3PX1, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our SH3PX1 Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol SNX9