Home » SH2B2 » SH2B2 Proteins » SH2B2 Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

SH2B2 Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for SH2B2 Protein (NBP2-13305PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

SH2B2 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human SH2B2.

Source: E. coli

Amino Acid Sequence: RDKWTRRLRLSRTLAAKVELVDIQREGALRFMVADD

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
SH2B2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-13305.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
22 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for SH2B2 Recombinant Protein Antigen

  • adaptor protein with pleckstrin homology and src homology 2 domains
  • APSAdapter protein with pleckstrin homology and Src homology 2 domains
  • SH2 and PH domain-containing adapter protein APS
  • SH2B adapter protein 2
  • SH2B adaptor protein 2

Background

APS (adapter protein with Pleckstrin homology and Src homology 2 domains) is a member of the Lnk family, an adapter protein that is involved in B cell signaling, insulin signaling and cytoskeletal reorganization. A PH and an SH2 domain containing adapter protein that links activated tyrosine kinases to signaling pathways. It is tyrosine phosphorylated by JAK2, KIT and other kinases during B cell receptor stimulation of many different cytokines, chemokines and leukokines. APS has been shown to inhibit the JAK STAT pathway in collaboration with cCbl.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

Prothrombin
Antibody
NBP1-58268
Immunohistochemistry-Paraffin Prothrombin Antibody
Immunohistochemistry-Paraffin Prothrombin Antibody
Western Blot Prothrombin Antibody
(1 Review)
(3 Publications)
Species: Hu, Mu
Applications: IHC, IHC-P, WB
TNF-alpha
[Unconjugated]
210-TA
SDS-PAGE TNF-alpha [Unconjugated]
Bioactivity TNF-alpha [Unconjugated]
SEC-MALS TNF-alpha [Unconjugated]
(3 Reviews)
(817 Publications)
Species: Hu
Applications: BA
Glucose 6
phosphate isomerase A ...
NBP2-02541
Western Blot Glucose 6 phosphate isomerase Antibody (OTI2D2)
Immunohistochemistry-Paraffin Glucose 6 phosphate isomerase Antibody (OTI2D2)
Immunohistochemistry-Paraffin Glucose 6 phosphate isomerase Antibody (OTI2D2)
(1 Publication)
Species: Hu, Pm, Mu, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Coagulation Factor
III/Tissue Factor [HR ...
DCF300
N/A Coagulation Factor III/Tissue Factor [HRP]
N/A Coagulation Factor III/Tissue Factor [HRP]
(26 Publications)
Species: Hu
Applications: ELISA
GNPDA1 Antibody
NBP2-24653
Western Blot GNPDA1 Antibody
Immunohistochemistry-Paraffin GNPDA1 Antibody
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Insulin Antibody
(182410) [Unconjugate ...
MAB1417
Immunocytochemistry Insulin Antibody (182410) [Unconjugated]
Immunohistochemistry Insulin Antibody (182410) [Unconjugated]
(24 Publications)
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
Autoimmune
Regulator/AIRE Antibo
NB100-1063
Western Blot Autoimmune Regulator/AIRE Antibody
Immunohistochemistry-Paraffin Autoimmune Regulator/AIRE Antibody
Flow Cytometry Autoimmune Regulator/AIRE Antibody
(1 Publication)
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA, WB
CBL Antibody
(3B12) - BSA Free
NBP2-37574
ELISA CBL Antibody (3B12) - BSA Free
Western Blot CBL Antibody (3B12) - BSA Free
Western Blot CBL Antibody (3B12) - BSA Free
(1 Review)
Species: Hu, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Recombinant Human
PRH2 GST (N-Term) Pro ...
H00005555-P01
SDS-PAGE Recombinant Human PRH2 GST (N-Term) Protein
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
Annexin V
Apoptosis Kit [FITC]
NBP2-29373
Flow Cytometry Annexin V Apoptosis Kit [FITC]
Flow Cytometry Annexin V Apoptosis Kit [FITC]
Flow Cytometry Annexin V Apoptosis Kit [FITC]
(2 Reviews)
(32 Publications)
Species: Hu, Mu, Rt
Applications: Flow-CS, Flow, ICC/IF
LNK/SH2B3 Antibody
(OTI2D8)
NBP2-00641
Flow Cytometry LNK/SH2B3 Antibody (OTI2D8)
Flow Cytometry LNK/SH2B3 Antibody (OTI2D8)
Western Blot LNK/SH2B3 Antibody (OTI2D8)
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Insulin Receptor
beta Antibody
NBP2-12793
Immunohistochemistry-Paraffin Insulin Receptor beta Antibody
Immunoprecipitation Insulin Receptor beta Antibody
(1 Review)
(3 Publications)
Species: Hu, Mu
Applications: IHC, IHC-P, IP, WB
Albumin Antibody
(188835) [Unconjugate ...
MAB1455
Simple Western Albumin Antibody (188835) [Unconjugated] - Serum
Immunocytochemistry Albumin Antibody (188835) [Unconjugated] - Serum
Immunohistochemistry Albumin Antibody (188835) [Unconjugated] - Serum
(3 Reviews)
(54 Publications)
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ICC, IHC, ICFlow, Simple Western, WB
Glutaminyl-peptide
Cyclotransferase/QPCT ...
NBP1-81838
Western Blot Glutaminyl-peptide Cyclotransferase/QPCT Antibody
Immunohistochemistry Glutaminyl-peptide Cyclotransferase/QPCT Antibody
Immunohistochemistry-Paraffin Glutaminyl-peptide Cyclotransferase/QPCT Antibody
(1 Publication)
Species: Hu, Mu
Applications: IHC, IHC-P, WB
IL-6 [HRP]
M6000B
N/A IL-6 [HRP]
N/A IL-6 [HRP]
N/A IL-6 [HRP]
(663 Publications)
Species: Mu
Applications: ELISA
SH2B1 Antibody
AF6915
Western Blot SH2B1 Antibody
Species: Hu, Mu, Rt
Applications: WB
Phenylalanine
Hydroxylase Antibody
NBP2-48615
Immunohistochemistry-Paraffin Phenylalanine Hydroxylase Antibody
Immunohistochemistry-Paraffin Phenylalanine Hydroxylase Antibody
Immunohistochemistry-Paraffin Phenylalanine Hydroxylase Antibody
(1 Publication)
Species: Hu
Applications: IHC, IHC-P, WB
IL-2 [Unconjugated]
202-IL
Bioactivity IL-2 [Unconjugated]
(4 Reviews)
(377 Publications)
Species: Hu
Applications: BA

Publications for SH2B2 Protein (NBP2-13305PEP) (0)

There are no publications for SH2B2 Protein (NBP2-13305PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SH2B2 Protein (NBP2-13305PEP) (0)

There are no reviews for SH2B2 Protein (NBP2-13305PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for SH2B2 Protein (NBP2-13305PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional SH2B2 Products

Array NBP2-13305PEP

Blogs on SH2B2

There are no specific blogs for SH2B2, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
TNF-alpha [Unconjugated]
210-TA-005
As an alternative, please consider our next generation Recombinant Human IL-2 (BT-002). It has equivalent bioactivity to Recombinant Human IL-2 (Catalog # 202-IL). It combines R&D Systems quality with scalability that allows for a solid supply chain. Both Recombinant Human IL-2 proteins are measured in a cell proliferation assay using CTLL 2 mouse cytotoxic T cells.
IL-2 [Unconjugated]
202-IL-010

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our SH2B2 Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol SH2B2