![Western Blot: SGPP1 Antibody [NBP1-91353] - Differential expression of SGPP1 and SPL in normal FLS and RAFLS. Proteins from whole cell lysates were prepared for Western blot. Total PI3-kinase p85 subunit was used as a control for protein loading. Data presented are from a representative blot (upper panel) or the means +/- SE from three experiments (lower panel). For statistical comparative analyses, the samples stimulated with CoCl2 at 0 h were compared to those treated for indicated times. p < 0.05. Image collected and cropped by CiteAb from the following publication (//www.hindawi.com/journals/mi/2015/436525/) licensed under a CC-BY license.](http://images.novusbio.com/fullsize/SGPP1-Antibody-Western-Blot-NBP1-91353-img0005.jpg "Western Blot: SGPP1 Antibody [NBP1-91353] - Differential expression of SGPP1 and SPL in normal FLS and RAFLS. Proteins from whole cell lysates were prepared for Western blot. Total PI3-kinase p85 subunit was used as a control for protein loading. Data presented are from a representative blot (upper panel) or the means +/- SE from three experiments (lower panel). For statistical comparative analyses, the samples stimulated with CoCl2 at 0 h were compared to those treated for indicated times. p < 0.05. Image collected and cropped by CiteAb from the following publication (//www.hindawi.com/journals/mi/2015/436525/) licensed under a CC-BY license.")
| Reactivity | Hu, MuSpecies Glossary |
| Applications | WB |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Concentration | 0.5 mg/ml |
| Description | The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution. |
| Immunogen | Synthetic peptide directed towards the middle region of human SGPP1. Peptide sequence THKYAPFIIIGLHLALGIFSFTLDTWSTSRGDTAEILGSGAGIACGSHVT. The peptide sequence for this immunogen was taken from within the described region. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | SGPP1 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
|
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS, 2% Sucrose |
| Preservative | 0.09% Sodium Azide |
| Concentration | 0.5 mg/ml |
| Purity | Affinity purified |
![Simple Western CD44 Antibody (2C5) [Unconjugated] - s Pan Specific](https://images.novusbio.com/images2/CD44_BBA10_Simple_Western_21377.jpg)
![Western Blot CD44 Antibody (2C5) [Unconjugated] - s Pan Specific](https://images.novusbio.com/images2/CD44_BBA10_Western_Blot_21459.jpg)
![Immunohistochemistry CD44 Antibody (2C5) [Unconjugated] - s Pan Specific](https://images.novusbio.com/images2/CD44_BBA10_Immunohistochemistry_17361.jpg)
![Immunohistochemistry PTH Antibody (918462) [Unconjugated]](https://images.novusbio.com/images2/PTH_MAB7665_Immunohistochemistry_16650.jpg)
![Western Blot PTH Antibody (918462) [Unconjugated]](https://images.novusbio.com/images2/PTH_MAB7665_Western_Blot_16656.jpg)
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Western Blot: SGPP1 Antibody [NBP1-91353] - Jurkat cell lysate, concentration 0.2-1 ug/ml.](http://images.novusbio.com/fullsize/SGPP1-Antibody-Western-Blot-NBP1-91353-img0002.jpg "Western Blot: SGPP1 Antibody [NBP1-91353] - Jurkat cell lysate, concentration 0.2-1 ug/ml.")
![Bioactivity IBSP/Sialoprotein II [Unconjugated]](https://images.novusbio.com/images/4014-sp_recombinant-human-ibsp-sialoprotein-ii-protein-cf-bioactivity-4420249391..jpg)
![Western Blot SPARC Antibody [Unconjugated]](https://images.novusbio.com/images2/SPARC_AF942_Western_Blot_20730.jpg)
![Immunohistochemistry SPARC Antibody [Unconjugated]](https://images.novusbio.com/images2/SPARC_AF942_Immunohistochemistry_10419.jpg)
![Immunocytochemistry SPARC Antibody [Unconjugated]](https://images.novusbio.com/images2/SPARC_AF942_Immunocytochemistry__Immunofluorescence_23321.jpg)
![Immunocytochemistry RUNX2/CBFA1 Antibody (232902) [Unconjugated]](https://images.novusbio.com/images2/RUNX2_MAB2006_Immunocytochemistry_13309.jpg)
![Bioactivity BMP-2 [Unconjugated]](https://images.novusbio.com/images/protein/355-bm_recombinant-human-mouse-rat-bmp-2-protein-bioactivity-181120209742.jpg)
![SDS-PAGE TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNF-alpha_210-TA_256.jpg)
![Bioactivity TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNFalpha_210TA_1658.jpg)
![SEC-MALS TNF-alpha [Unconjugated]](https://images.novusbio.com/images/210-ta_recombinant-human-tnf-alpha-protein-sec-mals-35202312244..jpg)
![N/A Osteoprotegerin/TNFRSF11B [Biotin]](https://images.novusbio.com/images2/DATA_Osteoprotegerin_DY805_ELISA_2238.jpg)
![N/A CCL27/CTACK [HRP]](https://images.novusbio.com/images2/CCL27_DCC270_ELISA_54.jpg)
![N/A CCL27/CTACK [HRP]](https://images.novusbio.com/images2/DATA_CCL27_DCC270_ELISA_615.jpg)
![N/A SLPI [HRP]](https://images.novusbio.com/images2/DATA_SLPI_DPI00_ELISA_792.jpg)
![N/A SLPI [HRP]](https://images.novusbio.com/images2/SLPI_DPI00_ELISA_160.jpg)
![Western Blot c-jun [p Ser63] Antibody (1018Y) [Unconjugated]](https://images.novusbio.com/images2/cJun_MAB8930_Western_Blot_18923.jpg)
![Immunocytochemistry c-jun [p Ser63] Antibody (1018Y) [Unconjugated]](https://images.novusbio.com/images2/cJun_MAB8930_Immunocytochemistry__Immunofluorescence_18945.jpg)
![Simple Western c-jun [p Ser63] Antibody (1018Y) [Unconjugated]](https://images.novusbio.com/images2/cJun_MAB8930_Simple_Western_19175.jpg)
![N/A CCL2/JE/MCP-1 [HRP]](https://images.novusbio.com/images2/CCL2_DCP00_ELISA_67.jpg)
![N/A CCL2/JE/MCP-1 [HRP]](https://images.novusbio.com/images2/DATA_CCL2_DCP00_ELISA_633.jpg)
![N/A CCL2/JE/MCP-1 [HRP]](https://images.novusbio.com/images2/DATA_CCL2_DCP00_ELISA_634.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")