Home » SET1B » SET1B Proteins » SET1B Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

SET1B Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for SET1B Protein (NBP1-87896PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

SET1B Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human SETD1B.

Source: E. coli

Amino Acid Sequence: DSLGMEEEVDIETEAVAPEERPSMLDEPPLPVGVEEPADSREPPEEPGLSQEGAMLLSPEPPAKEVEARPPLSPER

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
SETD1B
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-87896.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for SET1B Recombinant Protein Antigen

  • EC 2.1.1
  • FLJ20803
  • histone-lysine N-methyltransferase SETD1B
  • hSET1B
  • KIAA1076EC 2.1.1.43
  • KMT2GSET1B
  • Lysine N-methyltransferase 2G
  • SET domain containing 1B
  • SET domain-containing protein 1B
  • Set1B

Background

hSET1B is a histone methyltransferase that associates in a complex with the non-catalytic subunits CFP1, Rbbp5, Ash2, Wdr5, and Wdr82. These five non-catalytic subunits are also part of the Set1A complex. The SET1B complex has been shown to catalyze the tri-methylation of 'Lys-4' on histone H3. SET1B has been shown to localize to sites independent of SET1A complexes indicating non-redundant functions between SET1B and SET1A complexes. hSET1B include SET domain-containing protein 1B, lysine N-methyltransferase 2G, SETD1B, KMT2G, SET1B, and KIAA1076.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

SETD1A Antibody
NB100-558
Immunoprecipitation SETD1A Antibody
Western Blot SETD1A Antibody
Immunohistochemistry-Paraffin SETD1A Antibody
(5 Publications)
Species: Hu, Mu
Applications: ChIP, CHIP-SEQ, IHC, IHC-P, IP, WB
CXXC1 Antibody
(SR2392)
NBP3-27690
Immunocytochemistry/ Immunofluorescence CXXC1 Antibody (SR2392)
Immunohistochemistry-Paraffin CXXC1 Antibody (SR2392)
Western Blot CXXC1 Antibody (SR2392)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IP, WB
Histone H3
Antibody - BSA Free
NB500-171
Immunohistochemistry-Paraffin Histone H3 Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence Histone H3 Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence Histone H3 Antibody - BSA Free
(8 Reviews)
(34 Publications)
Species: Hu, I, Mu, Rt, Xp, Ye
Applications: ChIP, IB, ICC/IF, IHC, IHC-P, Single-Cell Western, WB
ASH2L Antibody
NB600-250
Western Blot ASH2L Antibody
Western Blot ASH2L Antibody
Immunohistochemistry-Paraffin ASH2L Antibody
(13 Publications)
Species: Hu
Applications: IHC, IHC-P, IP, WB
WDR5 Antibody
[Unconjugated]
AF5810
Western Blot WDR5 Antibody [Unconjugated]
Immunohistochemistry WDR5 Antibody [Unconjugated]
Immunocytochemistry/ Immunofluorescence WDR5 Antibody [Unconjugated]
(7 Publications)
Species: Hu, Mu
Applications: IHC, WB
CCNY Antibody
NBP1-88542
Western Blot CCNY Antibody
Immunohistochemistry-Paraffin CCNY Antibody
(1 Publication)
Species: Hu
Applications: IHC, IHC-P, WB
RbBP5 Antibody
NB600-252
Chromatin Immunoprecipitation Sequencing RbBP5 Antibody
Western Blot RbBP5 Antibody
Western Blot RbBP5 Antibody
(1 Review)
(13 Publications)
Species: Hu, Mu
Applications: ChIP, CHIP-SEQ, ICC/IF, IHC, IHC-P, IP, WB
MLL3 Antibody
(6D1B9)
NBP3-27147
Flow Cytometry MLL3 Antibody (6D1B9)
Immunocytochemistry/ Immunofluorescence MLL3 Antibody (6D1B9)
Western Blot MLL3 Antibody (6D1B9)
Species: Hu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
WDR82 Antibody
NBP2-57428
Western Blot WDR82 Antibody
Immunocytochemistry/ Immunofluorescence WDR82 Antibody
Species: Hu
Applications: ICC/IF, WB
DNMT1 Antibody
(60B1220.1) - BSA Fre
NB100-56519
Flow Cytometry DNMT1 Antibody (60B1220.1) - BSA Free
Flow Cytometry DNMT1 Antibody (60B1220.1) - BSA Free
Immunoprecipitation DNMT1 Antibody (60B1220.1) - BSA Free
(4 Reviews)
(144 Publications)
Species: Bv, Hu, Mu, Po, Rt, Sh
Applications: ChIP, CyTOF-ready, Flow-IC, Flow, ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, IP, KD, Simple Western, WB
ASCL2/Mash2
Antibody [Unconjugate
AF6539
Western Blot ASCL2/Mash2 Antibody [Unconjugated]
Immunohistochemistry ASCL2/Mash2 Antibody [Unconjugated]
(3 Publications)
Species: Hu
Applications: IHC, WB
PIGP Antibody
NBP1-84294
Western Blot PIGP Antibody
Immunocytochemistry/ Immunofluorescence PIGP Antibody
Immunohistochemistry-Paraffin PIGP Antibody
(1 Publication)
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
RBM15 Antibody
NBP1-82465
Immunocytochemistry/ Immunofluorescence RBM15 Antibody
Immunohistochemistry-Paraffin RBM15 Antibody
Immunohistochemistry-Paraffin RBM15 Antibody
(1 Publication)
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Mkl1 Antibody
NBP1-88498
Immunohistochemistry-Paraffin Mkl1 Antibody
Immunohistochemistry-Paraffin Mkl1 Antibody
Immunohistochemistry-Paraffin Mkl1 Antibody
(8 Publications)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, KD, WB
Menin Antibody
NB100-215
Immunoprecipitation Menin Antibody
Western Blot Menin Antibody
Western Blot Menin Antibody
(26 Publications)
Species: Hu, Mu
Applications: IHC, IHC-P, IP, Simple Western, WB
APE Antibody
(13B8E5C2) - BSA Free
NB100-116
Immunocytochemistry/ Immunofluorescence APE Antibody (13B8E5C2) - BSA Free
Western Blot APE Antibody (13B8E5C2) - BSA Free
Chromatin Immunoprecipitation (ChIP) APE Antibody (13B8E5C2) - BSA Free
(3 Reviews)
(107 Publications)
Species: Hu, Mu, Pm, Rt
Applications: ChIP, ELISA, GS, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD, PLA, Simple Western, WB

Publications for SET1B Protein (NBP1-87896PEP) (0)

There are no publications for SET1B Protein (NBP1-87896PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SET1B Protein (NBP1-87896PEP) (0)

There are no reviews for SET1B Protein (NBP1-87896PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for SET1B Protein (NBP1-87896PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional SET1B Products

Array NBP1-87896PEP

Blogs on SET1B

There are no specific blogs for SET1B, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Flow Cytometry: DNMT1 Antibody (60B1220.1) [NB100-56519] - Analysis of PE conjugate of NB100-56519. An intracellular stain was performed on HeLa cells with DNMT1 antibody (60B1220.1) NB100-56519PE (blue) and a matched isotype control NBP2-27287PE (orange). Cells were fixed with 4% PFA and then permeablized with 0
DNMT1 Antibody (60B1220.1) - BSA Free
NB100-56519
Immunocytochemistry/Immunofluorescence: APE Antibody (13B8E5C2) - BSA Free [NB100-116] - APE Antibody (13B8E5C2) [NB100-116] - HeLa cells were fixed for 10 minutes using 10% formalin and then permeabilized for 5 minutes using 1X PBS + 0.05% Triton X-100. The cells were incubated with anti-APE (13B8E5C2) at 5 ug/mL overnight at 4C and detected with an anti-mouse DyLight 488 (Green) at a 1:500 dilution. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 40X objective.
APE Antibody (13B8E5C2) - BSA Free
NB100-116

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our SET1B Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol SETD1B