Seryl tRNA synthetase Antibody (1H4) - Azide and BSA Free Summary
| Description |
Quality control test: Antibody Reactive Against Recombinant Protein. |
| Immunogen |
SARS (AAH00716, 1 a.a. ~ 514 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MVLDLDLFRVDKGGDPALIRETQEKRFKDPGLVDQLVKADSEWRRCRFRADNLNKLKNLCSKTIGEKMKKKEPVGDDESVPENVLSFDDLTADALANLKVSQIKKVRLLIDEAILKCDAERIKLEAERFENLREIGNLLHPSVPISNDEDVDNKVERIWGDCTVRKKYSHVDLVVMVDGFEGEKGAVVAGSRGYFLKGVLVFLEQALIQYALRTLGSRGYIPIYTPFFMRKEVMQEVAQLSQFDEELYKVIGKGSEKSDDNSYDEKYLIATSEQPIAALHRDEWLRPEDLPIKYAGLSTCFRQEVGSHGRDTRGIFRVHQFEKIEQFVYSSPHDNKSWEMFEEMITTAEEFYQSLGIPYHIVNIVSGSLNHAASKKLDLEAWFPGSGAFRELVSCSNCTDYQARRLRIRYGQTKKMMDKVEFVHMLNATMCATTRTICAILENYQTEKGITVPEKLKEFMPPGLQELIPFVKPAPIEQEPSKKQKKQHEGSKKKAAARDVTLENRLQNMEVTDA |
| Specificity |
SARS - seryl-tRNA synthetase |
| Isotype |
IgG2a Kappa |
| Clonality |
Monoclonal |
| Host |
Mouse |
| Gene |
SARS |
| Purity |
IgG purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Chromatin Immunoprecipitation (ChIP)
- ELISA
- Immunocytochemistry/ Immunofluorescence
- Immunohistochemistry
- Immunohistochemistry-Paraffin
- Immunoprecipitation
- Knockdown Validated
- Western Blot
|
| Application Notes |
Antibody reactivity against recominant protein and cell lysate for WB. It has been used for IF, IHC-P, RNAi Validation and ELISA. |
| Publications |
|
Packaging, Storage & Formulations
| Storage |
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer |
In 1x PBS, pH 7.4 |
| Preservative |
No Preservative |
| Purity |
IgG purified |
Notes
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for Seryl tRNA synthetase Antibody (1H4) - Azide and BSA Free
Background
This gene belongs to the class II amino-acyl tRNA family. The encoded enzyme catalyzes the transfer of L-serine to tRNA (Ser) and is related to bacterial and yeast counterparts.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: BA
Species: Hu
Applications: WB
Species: Hu
Applications: BA
Species: Hu
Applications: WB
Species: Ca(-), Hu, Rt(-)
Applications: Flow-IC, Flow, ICC/IF, IF, IHC, IHC-P, MI, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, Simple Western, WB
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ICC, IHC, ICFlow, Simple Western, WB
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Dr, Hu, Mu, Rb, Rt
Applications: Flow-CS, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-P, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, WB
Species: Hu
Applications: ELISA
Species: Hu
Applications: PEP-ELISA, WB
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, Simple Western, WB
Species: Hu
Applications: IHC, IHC-P, KD, WB
Species: Hu
Applications: IHC, WB
Species: Hu
Applications: CyTOF-ready, Flow, IHC, WB
Species: Hu, Mu, Rt
Applications: WB
Species: Hu, Mu, Ze
Applications: WB, ELISA, ICC/IF, IHC, IP, ChIP, KD
Publications for Seryl tRNA synthetase Antibody (H00006301-M01)(4)
Showing Publications 1 -
4 of 4.
Reviews for Seryl tRNA synthetase Antibody (H00006301-M01) (0)
There are no reviews for Seryl tRNA synthetase Antibody (H00006301-M01).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Seryl tRNA synthetase Antibody (H00006301-M01) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Seryl tRNA synthetase Products
Research Areas for Seryl tRNA synthetase Antibody (H00006301-M01)
Find related products by research area.
|
Blogs on Seryl tRNA synthetase
![Western Blot: Seryl tRNA synthetase Antibody (1H4) [H00006301-M01] - SARS monoclonal antibody (M01), clone 1H4 Analysis of SARS expression in Jurkat.](http://images.novusbio.com/fullsize/Seryl-tRNA-synthetase-Antibody-1H4-Western-Blot-H00006301-M01-img0013.jpg "Western Blot: Seryl tRNA synthetase Antibody (1H4) [H00006301-M01] - SARS monoclonal antibody (M01), clone 1H4 Analysis of SARS expression in Jurkat.")
![Immunocytochemistry/Immunofluorescence: Seryl tRNA synthetase Antibody (1H4) [H00006301-M01] - Analysis of monoclonal antibody to SARS on HeLa cell. Antibody concentration 25 ug/ml.](http://images.novusbio.com/fullsize/Seryl-tRNA-synthetase-Antibody-1H4-Immunocytochemistry-Immunofluorescence-H00006301-M01-img0008.jpg "Immunocytochemistry/Immunofluorescence: Seryl tRNA synthetase Antibody (1H4) [H00006301-M01] - Analysis of monoclonal antibody to SARS on HeLa cell. Antibody concentration 25 ug/ml.")
![Immunohistochemistry-Paraffin: Seryl tRNA synthetase Antibody (1H4) [H00006301-M01] - Analysis of monoclonal antibody to SARS on formalin-fixed paraffin-embedded human colon tissue. Antibody concentration 3 ug/ml.](http://images.novusbio.com/fullsize/Seryl-tRNA-synthetase-Antibody-1H4-Immunohistochemistry-Paraffin-H00006301-M01-img0010.jpg "Immunohistochemistry-Paraffin: Seryl tRNA synthetase Antibody (1H4) [H00006301-M01] - Analysis of monoclonal antibody to SARS on formalin-fixed paraffin-embedded human colon tissue. Antibody concentration 3 ug/ml.")
![Western Blot: Seryl tRNA synthetase Antibody (1H4) [H00006301-M01] - Analysis of SARS over-expressed 293 cell line, cotransfected with SARS Validated Chimera RNAi ( Cat # H00006301-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with SARS monoclonal antibody (M01), clone 1H4 (Cat # H00006301-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.](http://images.novusbio.com/fullsize/Seryl-tRNA-synthetase-Antibody-1H4-Western-Blot-H00006301-M01-img0011.jpg "Western Blot: Seryl tRNA synthetase Antibody (1H4) [H00006301-M01] - Analysis of SARS over-expressed 293 cell line, cotransfected with SARS Validated Chimera RNAi ( Cat # H00006301-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with SARS monoclonal antibody (M01), clone 1H4 (Cat # H00006301-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.")
![Western Blot: Seryl tRNA synthetase Antibody (1H4) [H00006301-M01] - Analysis of SARS expression in transfected 293T cell line by SARS monoclonal antibody (M01), clone 1H4.Lane 1: SARS transfected lysate(58.8 KDa).Lane 2: Non-transfected lysate.](http://images.novusbio.com/fullsize/Seryl-tRNA-synthetase-Antibody-1H4-Western-Blot-H00006301-M01-img0014.jpg "Western Blot: Seryl tRNA synthetase Antibody (1H4) [H00006301-M01] - Analysis of SARS expression in transfected 293T cell line by SARS monoclonal antibody (M01), clone 1H4.Lane 1: SARS transfected lysate(58.8 KDa).Lane 2: Non-transfected lysate.")
![ELISA: Seryl tRNA synthetase Antibody (1H4) [H00006301-M01] - Detection limit for recombinant GST tagged SARS is approximately 0.03ng/ml as a capture antibody.](http://images.novusbio.com/fullsize/Seryl-tRNA-synthetase-Antibody-1H4-ELISA-H00006301-M01-img0015.jpg "ELISA: Seryl tRNA synthetase Antibody (1H4) [H00006301-M01] - Detection limit for recombinant GST tagged SARS is approximately 0.03ng/ml as a capture antibody.")
![SDS-PAGE LIGHT/TNFSF14 [Unconjugated]](https://images.novusbio.com/images2/LIGHT_664-LI_719.jpg)
![Bioactivity LIGHT/TNFSF14 [Unconjugated]](https://images.novusbio.com/images2/LIGHT_664-LI_721.jpg)
![Simple Western Albumin Antibody (188835) [Unconjugated] - Serum](https://images.novusbio.com/images2/Albumin_MAB1455_Simple_Western_21888.jpg)
![Immunocytochemistry Albumin Antibody (188835) [Unconjugated] - Serum](https://images.novusbio.com/images2/Albumin_MAB1455_Immunocytochemistry__Immunofluorescence_17777.jpg)
![Immunohistochemistry Albumin Antibody (188835) [Unconjugated] - Serum](https://images.novusbio.com/images2/Albumin_MAB1455_Immunohistochemistry_23317.jpg)
![Myoglobin Antibody [Unconjugated]](/sites/all/modules/enterprise-tech/et_datasheets/images/novus_guarantee.png "Myoglobin Antibody [Unconjugated]")
![N/A Kallikrein 3/PSA [HRP]](https://images.novusbio.com/images2/DATA_Kallikrein_3_DKK300_ELISA_729.jpg)
![N/A Kallikrein 3/PSA [HRP]](https://images.novusbio.com/images2/DATA_Kallikrein_3_DKK300_ELISA_730.jpg)
![N/A Kallikrein 3/PSA [HRP]](https://images.novusbio.com/images2/Kallikrein_3_DKK300_ELISA_124.jpg)
