SENP6 Antibody Summary
Description |
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution. |
Immunogen |
The immunogen for this antibody is Senp6 - C-terminal region. Peptide sequence LAVVCFPGLEKPKYEPNPHYHENAVMQKTPSAEDSCVSSASEMGACSQNS. The peptide sequence for this immunogen was taken from within the described region. |
Isotype |
IgG |
Clonality |
Polyclonal |
Host |
Rabbit |
Gene |
SENP6 |
Purity |
Affinity purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
|
Theoretical MW |
127 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Buffer |
PBS, 2% Sucrose |
Preservative |
0.09% Sodium Azide |
Concentration |
0.5 mg/ml |
Purity |
Affinity purified |
Alternate Names for SENP6 Antibody
Background
Senp6 is a protease that deconjugates SUMO1, SUMO2 and SUMO3 from targeted proteins. Senp6 rocesses preferentially poly-SUMO2 and poly-SUMO3 chains, but does not efficiently process SUMO1, SUMO2 and SUMO3 precursors. Senp6 deconjugates SUMO1 from RXRA, leading to transcriptional activation. Senp6 is involved in chromosome alignment and spindle assembly, by regulating the kinetochore CENPH-CENPI-CENPK complex. Senp6 desumoylates PML and CENPI, protecting them from degradation by the ubiquitin ligase RNF4, which targets polysumoylated proteins for proteasomal degradation and desumoylates also RPA1, thus preventing recruitment of RAD51 to the DNA damage foci to initiate DNA repair through homologous recombination.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, PLA, WB
Species: Hu
Applications: ICC
Species: Hu, Pm, Mu, Pm, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
Species: Mu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), ICC, IHC, Neut, WB
Species: Hu, Rt
Applications: ICC/IF, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: Flow, IB, ICC/IF, IHC, IHC-P, IP, KD, PLA, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, WB
Species: Hu
Applications: ELISA, IP, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: WB
Publications for SENP6 Antibody (NBP1-98428) (0)
There are no publications for SENP6 Antibody (NBP1-98428).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for SENP6 Antibody (NBP1-98428) (0)
There are no reviews for SENP6 Antibody (NBP1-98428).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for SENP6 Antibody (NBP1-98428) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional SENP6 Products
Blogs on SENP6