![Immunocytochemistry/Immunofluorescence: SEC31A Antibody [NBP1-89301] - Staining of human cell line U-251 MG shows localization to cytosol & vesicles. Antibody staining is shown in green.](http://images.novusbio.com/fullsize/SEC31A-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-89301-img0006.jpg "Immunocytochemistry/Immunofluorescence: SEC31A Antibody [NBP1-89301] - Staining of human cell line U-251 MG shows localization to cytosol & vesicles. Antibody staining is shown in green.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: NWREALAAVLTYAKPDEFSALCDLLGTRLENEGDSLLQTQACLCYICAGNVEKLVACWTKAQDGSHPLSLQDLIEKVVILRKAVQLTQAMDTSTVGVLLAAKMSQYANLLAAQGSIAAALAFLPDNTNQPNIMQLR |
| Predicted Species | Mouse (93%), Rat (92%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | SEC31A |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for SEC31A Antibody (NBP1-89301)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | SEC31A |
![Immunohistochemistry-Paraffin: SEC31A Antibody [NBP1-89301] - Staining of human skeletal muscle shows very weak positivity in myocytes.](http://images.novusbio.com/fullsize/SEC31A-Antibody-Immunohistochemistry-Paraffin-NBP1-89301-img0016.jpg "Immunohistochemistry-Paraffin: SEC31A Antibody [NBP1-89301] - Staining of human skeletal muscle shows very weak positivity in myocytes.")
![Immunohistochemistry-Paraffin: SEC31A Antibody [NBP1-89301] - Staining of human cerebral cortex shows positivity in neurons.](http://images.novusbio.com/fullsize/SEC31A-Antibody-Immunohistochemistry-Paraffin-NBP1-89301-img0013.jpg "Immunohistochemistry-Paraffin: SEC31A Antibody [NBP1-89301] - Staining of human cerebral cortex shows positivity in neurons.")
![Immunohistochemistry-Paraffin: SEC31A Antibody [NBP1-89301] - Staining of human endometrium shows positivity in glandular cells.](http://images.novusbio.com/fullsize/SEC31A-Antibody-Immunohistochemistry-Paraffin-NBP1-89301-img0014.jpg "Immunohistochemistry-Paraffin: SEC31A Antibody [NBP1-89301] - Staining of human endometrium shows positivity in glandular cells.")
![Immunohistochemistry-Paraffin: SEC31A Antibody [NBP1-89301] - Staining of human liver shows positivity in hepatocytes.](http://images.novusbio.com/fullsize/SEC31A-Antibody-Immunohistochemistry-Paraffin-NBP1-89301-img0015.jpg "Immunohistochemistry-Paraffin: SEC31A Antibody [NBP1-89301] - Staining of human liver shows positivity in hepatocytes.")
![Western Blot ALK/CD246 Antibody [Unconjugated]](https://images.novusbio.com/images2/ALK_AF4210_Western_Blot_12746.jpg)
![Immunohistochemistry ALK/CD246 Antibody [Unconjugated]](https://images.novusbio.com/images2/12780.jpg)
![Simple Western ALK/CD246 Antibody [Unconjugated]](https://images.novusbio.com/images/antibody/af4210_human-alk-cd246-affinity-purified-pab-simple-western-296202315837.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")