Home » SCAP2 » SCAP2 Proteins » SCAP2 Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

SCAP2 Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for SCAP2 Protein (NBP2-47289PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

SCAP2 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human SKAP2.

Source: E. coli

Amino Acid Sequence: LPEEIRNLLADVETFVADILKGENLSKKAKEKRESLIKKIKDVKSIYLQEFQDKGDAEDGEEYDDPFAGPPDTISLASERYDKDDEAPSDGAQFPPIAAQDLPFVLKAGYLEKRRKDHSFLGFEWQKRWCALSKTVFYY

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
SKAP2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-47289.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
34 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for SCAP2 Recombinant Protein Antigen

  • Fyn-associated phosphoprotein SKAP55 homologue
  • PRAP
  • RA70Pyk2/RAFTK-associated protein
  • Retinoic acid-induced protein 70
  • SAPSSKAP55 homolog
  • SCAP2MGC33304
  • SKAP55RSKAP-55HOM
  • SKAP-HOMMGC10411
  • src family associated phosphoprotein 2
  • Src family-associated phosphoprotein 2
  • src kinase associated phosphoprotein 2
  • src kinase-associated phosphoprotein 2
  • Src kinase-associated phosphoprotein 55-related protein
  • src kinase-associated phosphoprotein of 55-related protein
  • Src-associated adapter protein with PH and SH3 domains
  • src-associated adaptor protein

Background

SCAP2 is encoded by this gene belongs to the src family kinases. This protein is similar to the src kinase associated phosphoprotein 1. It is an adaptor protein that is thought to play an essential role in the src signaling pathway in various cells. It inhibits PTK2B/RAFTK activity and regulates alpha-synuclein phosphorylation.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

USH1G Antibody
NBP1-89076
Immunohistochemistry-Paraffin USH1G Antibody
(1 Publication)
Species: Ca, Hu
Applications: IHC, IHC-P, WB
C-Reactive
Protein/CRP [Biotin]
DY1707
N/A C-Reactive Protein/CRP [Biotin]
(68 Publications)
Species: Hu
Applications: ELISA
ELK3 Antibody
(OTI1H3)
NBP2-01264
Western Blot ELK3 Antibody (OTI1H3)
Flow Cytometry ELK3 Antibody (OTI1H3)
Western Blot ELK3 Antibody (OTI1H3)
(1 Review)
(4 Publications)
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
IL-6 [HRP]
M6000B
N/A IL-6 [HRP]
N/A IL-6 [HRP]
N/A IL-6 [HRP]
(661 Publications)
Species: Mu
Applications: ELISA
SH2D1A Antibody
(1C9)
H00004068-M01
Western Blot SH2D1A Antibody (1C9)
Flow Cytometry SH2D1A Antibody (1C9)
ELISA SH2D1A Antibody (1C9)
(1 Review)
(9 Publications)
Species: Hu, Mu
Applications: ELISA, Flow, Func, WB
Pentraxin 2/SAP
Antibody [Unconjugate
AF2558
Western Blot Pentraxin 2/SAP Antibody [Unconjugated]
Simple Western Pentraxin 2/SAP Antibody [Unconjugated]
(3 Publications)
Species: Hu, Mu
Applications: Simple Western, WB
Albumin Antibody
(188835) [Unconjugate ...
MAB1455
Simple Western Albumin Antibody (188835) [Unconjugated] - Serum
Immunocytochemistry Albumin Antibody (188835) [Unconjugated] - Serum
Immunohistochemistry Albumin Antibody (188835) [Unconjugated] - Serum
(3 Reviews)
(54 Publications)
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ICC, IHC, ICFlow, Simple Western, WB
PSAP Antibody
[Unconjugated]
AF8520
Immunocytochemistry PSAP Antibody [Unconjugated]
Western Blot PSAP Antibody [Unconjugated]
Simple Western PSAP Antibody [Unconjugated]
(1 Review)
(2 Publications)
Species: Hu
Applications: ICC, Simple Western, WB
TNF-alpha
[Unconjugated]
210-TA
SDS-PAGE TNF-alpha [Unconjugated]
Bioactivity TNF-alpha [Unconjugated]
SEC-MALS TNF-alpha [Unconjugated]
(3 Reviews)
(811 Publications)
Species: Hu
Applications: BA
NDUFB6 Antibody
NBP1-92172
Immunohistochemistry-Paraffin NDUFB6 Antibody
Western Blot NDUFB6 Antibody
Immunocytochemistry/ Immunofluorescence NDUFB6 Antibody
(2 Publications)
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
LYPD4 Antibody
NBP1-58023
Western Blot LYPD4 Antibody
Species: Hu
Applications: WB
beta-Defensin 4/2
Antibody
AF2758
Immunohistochemistry beta-Defensin 4/2 Antibody
Immunohistochemistry beta-Defensin 4/2 Antibody
(6 Publications)
Species: Hu
Applications: IHC, WB
ELK4 Antibody
NBP1-87092
Immunocytochemistry/ Immunofluorescence ELK4 Antibody
Western Blot ELK4 Antibody
Immunohistochemistry-Paraffin ELK4 Antibody
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
PTPRH Antibody
NBP2-20005
Immunohistochemistry-Paraffin PTPRH Antibody
Western Blot PTPRH Antibody
Immunocytochemistry/ Immunofluorescence PTPRH Antibody
(1 Publication)
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
FYB/ADAP/SLAP130
Antibody [Unconjugate ...
AF3857
Western Blot FYB/ADAP/SLAP130 Antibody [Unconjugated]
Species: Hu
Applications: WB
CSRP1 Antibody
AF5739
Western Blot CSRP1 Antibody
Species: Hu, Mu, Rt
Applications: WB
Src [p Tyr419]
Antibody [Unconjugate
AF2685
Western Blot Src [p Tyr419] Antibody [Unconjugated]
Simple Western Src [p Tyr419] Antibody [Unconjugated]
Immunohistochemistry Src [p Tyr419] Antibody [Unconjugated]
(1 Review)
(10 Publications)
Species: Hu
Applications: IHC, Simple Western, WB
SKAP55 Antibody
(3D3)
H00008631-M01
Immunohistochemistry-Paraffin SKAP55 Antibody (3D3)
Immunohistochemistry SKAP55 Antibody (3D3)
(1 Review)
Species: Hu
Applications: ELISA, IHC, IHC-P, WB
p19ARF/CDKN2A
Antibody - BSA Free
NB200-106
Immunohistochemistry p19ARF/CDKN2A Antibody - BSA Free
Western Blot p19ARF/CDKN2A Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence p19ARF/CDKN2A Antibody - BSA Free
(1 Review)
(48 Publications)
Species: Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, WB
Kallikrein 3/PSA
[HRP]
DKK300
N/A Kallikrein 3/PSA [HRP]
N/A Kallikrein 3/PSA [HRP]
N/A Kallikrein 3/PSA [HRP]
(17 Publications)
Species: Hu
Applications: ELISA

Publications for SCAP2 Protein (NBP2-47289PEP) (0)

There are no publications for SCAP2 Protein (NBP2-47289PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SCAP2 Protein (NBP2-47289PEP) (0)

There are no reviews for SCAP2 Protein (NBP2-47289PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for SCAP2 Protein (NBP2-47289PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional SCAP2 Products

Research Areas for SCAP2 Protein (NBP2-47289PEP)

Find related products by research area.

Blogs on SCAP2

There are no specific blogs for SCAP2, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
TNF-alpha [Unconjugated]
210-TA-005

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our SCAP2 Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol SKAP2