Home » SASH3 » SASH3 Proteins » SASH3 Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

SASH3 Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for SASH3 Protein (NBP1-92364PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

SASH3 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human SASH3.

Source: E. coli

Amino Acid Sequence: PKTLHELLERIGLEEHTSTLLLNGYQTLEDFKELRETHLNELNIMDPQHRAKLLTAAELLLDYDTGSEEAEEGAESSQEPVAHTVSEPKVDIPRDSGCFEGSESGRDDAELAGTEEQLQGLSL

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
SASH3
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-92364.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
31 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for SASH3 Recombinant Protein Antigen

  • CXorf9
  • HACS2
  • SAM and SH3 domain containing 3
  • SAM and SH3 domain-containing protein 3
  • SH3 protein expressed in lymphocytes homolog
  • SH3D6C
  • SLYchromosome X open reading frame 9,753P9

Background

The protein encoded by the SASH3 gene contains a Src homology-3 (SH3) domain and a sterile alpha motif (SAM), both of which are found in proteins involved in cell signaling. This protein may function as a signaling adapter protein in lymphocytes.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

MRP1 Antibody
(IU2H10) - BSA Free
NB400-156
Dual RNAscope ISH-IHC MRP1 Antibody (IU2H10) - BSA Free
Western Blot MRP1 Antibody (IU2H10) - BSA Free
Immunocytochemistry/ Immunofluorescence MRP1 Antibody (IU2H10) - BSA Free
(17 Publications)
Species: Hu, Mu, Rt
Applications: CyTOF-ready, Dual ISH-IHC, ELISA, Flow, ICC/IF, IHC, IP, Simple Western, WB
MARCKS like
protein Antibody
NBP2-38160
Immunohistochemistry-Paraffin MARCKS like protein Antibody
Immunohistochemistry-Paraffin MARCKS like protein Antibody
Immunohistochemistry-Paraffin MARCKS like protein Antibody
Species: Hu
Applications: ICC/IF, IHC, IHC-P
GPR177/WLS Antibody
NBP2-57299
Western Blot GPR177/WLS Antibody
Immunohistochemistry-Paraffin GPR177/WLS Antibody
(1 Review)
Species: Hu
Applications: IHC, IHC-P, WB
SAMSN1 Antibody
NBP1-82598
Immunocytochemistry/ Immunofluorescence SAMSN1 Antibody
Western Blot SAMSN1 Antibody
Western Blot SAMSN1 Antibody
(1 Publication)
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB

beta-Glucuronidase/GUS
NBP1-87511
Immunocytochemistry/ Immunofluorescence beta-Glucuronidase/GUSB Antibody
Immunohistochemistry-Paraffin beta-Glucuronidase/GUSB Antibody
Immunohistochemistry-Paraffin beta-Glucuronidase/GUSB Antibody
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
SCFD1 Antibody
(OTI5G4)
NBP2-02031
Western Blot SCFD1 Antibody (OTI5G4)
Immunohistochemistry-Paraffin SCFD1 Antibody (OTI5G4)
Immunohistochemistry-Paraffin SCFD1 Antibody (OTI5G4)
Species: Ca, Hu, Pm, Mu, Pm, Rt
Applications: IHC, IHC-P, WB
Perforin Antibody
(CB5.4) - BSA Free
NBP1-97512
Western Blot Perforin Antibody (CB5.4) - BSA Free
(7 Publications)
Species: Mu
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Glutamate
Dehydrogenase Antibod
NBP2-16679
Western Blot Glutamate Dehydrogenase Antibody
Immunocytochemistry/ Immunofluorescence Glutamate Dehydrogenase Antibody
Immunohistochemistry-Paraffin Glutamate Dehydrogenase Antibody
(4 Publications)
Species: Dr, Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Glucose
1-dehydrogenase Antib ...
NBP2-02615
Western Blot Glucose 1-dehydrogenase Antibody (OTI2A7)
Flow Cytometry Glucose 1-dehydrogenase Antibody (OTI2A7)
Flow Cytometry Glucose 1-dehydrogenase Antibody (OTI2A7)
Species: Hu, Pm, Pm
Applications: Flow, ICC/IF, IHC, IHC-P, WB
UDP glucose
dehydrogenase Antibod
NBP1-90906
Western Blot UDP glucose dehydrogenase Antibody
Immunohistochemistry-Paraffin UDP glucose dehydrogenase Antibody
Immunohistochemistry-Paraffin UDP glucose dehydrogenase Antibody
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
GAPDH Antibody
(1D4)
NB300-221
Western Blot GAPDH Antibody (1D4)
Immunocytochemistry/ Immunofluorescence GAPDH Antibody (1D4)
Immunocytochemistry/ Immunofluorescence GAPDH Antibody (1D4)
(19 Reviews)
(425 Publications)
Species: Av, Bv, Ca, Ch, ChHa, Dr, Eq, Fe, Ha, Hu, Mu, Ma-Op, Po, Pm, Rb, Rt, Sh, Ze
Applications: ChIP, ICC/IF, IHC, IHC-Fr, IP, KD, Simple Western, Single-Cell Western, WB
Rab1A Antibody
NBP1-55113
Western Blot Rab1A Antibody
Western Blot Rab1A Antibody
Immunohistochemistry Rab1A Antibody
Species: Hu, Pm, Mu
Applications: IHC, IHC-P, WB
Src [p Tyr419]
Antibody [Unconjugate
AF2685
Western Blot Src [p Tyr419] Antibody [Unconjugated]
Simple Western Src [p Tyr419] Antibody [Unconjugated]
Immunohistochemistry Src [p Tyr419] Antibody [Unconjugated]
(1 Review)
(10 Publications)
Species: Hu
Applications: IHC, Simple Western, WB
FATP5/SLC27A5
Antibody (9C4D1) - BS ...
NBP2-37412
ELISA FATP5/SLC27A5 Antibody (9C4D1) - BSA Free
Western Blot FATP5/SLC27A5 Antibody (9C4D1) - BSA Free
Western Blot FATP5/SLC27A5 Antibody (9C4D1) - BSA Free
(4 Publications)
Species: Hu, Mu
Applications: ELISA, IHC, IHC-P, WB
IL-6 [HRP]
M6000B
N/A IL-6 [HRP]
N/A IL-6 [HRP]
N/A IL-6 [HRP]
(660 Publications)
Species: Mu
Applications: ELISA
TNF-alpha
[Unconjugated]
210-TA
SDS-PAGE TNF-alpha [Unconjugated]
Bioactivity TNF-alpha [Unconjugated]
SEC-MALS TNF-alpha [Unconjugated]
(3 Reviews)
(811 Publications)
Species: Hu
Applications: BA
Carboxyl Ester
Lipase/CEL Antibody
NBP1-88502
Immunohistochemistry-Paraffin Carboxyl Ester Lipase/CEL Antibody
Immunohistochemistry-Paraffin Carboxyl Ester Lipase/CEL Antibody
Immunohistochemistry-Paraffin Carboxyl Ester Lipase/CEL Antibody
Species: Hu
Applications: IHC, IHC-P
SASH3 Recombinant
Protein Antigen
NBP1-92364PEP
SASH3 Recombinant Protein Antigen
Species: Hu
Applications: AC

Publications for SASH3 Protein (NBP1-92364PEP) (0)

There are no publications for SASH3 Protein (NBP1-92364PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SASH3 Protein (NBP1-92364PEP) (0)

There are no reviews for SASH3 Protein (NBP1-92364PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for SASH3 Protein (NBP1-92364PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional SASH3 Products

Blogs on SASH3

There are no specific blogs for SASH3, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
TNF-alpha [Unconjugated]
210-TA-005
Analysis of cell line lysates probed with mouse mAb to GAPDH (theoretical molecular weight: 36 kDa), NB300-221, dilution 1:2,000: [1] protein standard, [2] HEK293, [3] HeLa, [4] SH-SY5Y, [5] COS1, [6] NIH-3T3, and [7] C6 cells. The GAPDH antibody reveals a single band at ~37 kDa in all cell lines. GAPDH is a house keeping protein, the level of which is relatively unaffected by most experimental manipulations, and, as a result, this antibody has been widely used as a western blotting loading control.
GAPDH Antibody (1D4)
NB300-221

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our SASH3 Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol SASH3