Home » SARS2 » SARS2 Proteins » SARS2 Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

SARS2 Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for SARS2 Protein (NBP2-33666PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

SARS2 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human SARS2.

Source: E. coli

Amino Acid Sequence: QIYNIDPARFKDLNLAGTAEVGLAGYFMDHTVAFRDLPVRMVCSSTCYRAETNTGQEPRGLYRVHHFTKVEMFGVTGPGL

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
SARS2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-33666.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for SARS2 Recombinant Protein Antigen

  • EC 6.1.1.11
  • FLJ20450
  • mitochondrial seryl-tRNA synthetase
  • mtSerRS
  • SARS
  • serine tRNA ligase 2, mitochondrial
  • Serine--tRNA ligase
  • serine-tRNA ligase, mitochondrial
  • SerRS
  • SerRSmtSARSM
  • SERS
  • seryl-tRNA synthetase 2
  • seryl-tRNA synthetase 2, mitochondrial
  • seryl-tRNA synthetase, mitochondrial
  • Seryl-tRNA(Ser/Sec) synthetase
  • SYS

Background

The SARS2 gene encodes the mitochondrial seryl-tRNA synthethase precursor, a member of the class II tRNA synthetase family. The mature enzyme catalyzes the ligation of Serine to tRNA(Ser) and participates in the biosynthesis of selenocysteinyl-tRNA(sec) in mit

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

LIGHT/TNFSF14
[Unconjugated]
664-LI
SDS-PAGE LIGHT/TNFSF14 [Unconjugated]
Bioactivity LIGHT/TNFSF14 [Unconjugated]
(21 Publications)
Species: Hu
Applications: BA
Afamin Antibody
AF8065
Western Blot Afamin Antibody
(1 Publication)
Species: Hu
Applications: WB
PMEL17/SILV
Antibody (HMB45)
NBP2-44520
Flow (Intracellular) PMEL17/SILV Antibody (HMB45)
Flow (Intracellular) PMEL17/SILV Antibody (HMB45)
Immunohistochemistry PMEL17/SILV Antibody (HMB45)
(8 Publications)
Species: Ca(-), Hu, Rt(-)
Applications: Flow-IC, Flow, ICC/IF, IF, IHC, IHC-P, MI, WB
SI
Sucrase-Isomaltase An
NBP1-87581
Immunohistochemistry-Paraffin SI Sucrase-Isomaltase Antibody
Immunohistochemistry-Paraffin SI Sucrase-Isomaltase Antibody
Immunohistochemistry-Paraffin SI Sucrase-Isomaltase Antibody
(1 Publication)
Species: Hu
Applications: IHC, IHC-P, WB
NOC2L Antibody
NBP1-92190
Immunocytochemistry/ Immunofluorescence NOC2L Antibody
Western Blot NOC2L Antibody
Immunohistochemistry-Paraffin NOC2L Antibody
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, Simple Western, WB
NK1R Antibody -
BSA Free
NB300-119
Western Blot NK1R Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence NK1R Antibody - BSA Free
Immunohistochemistry NK1R Antibody - BSA Free
(2 Reviews)
(44 Publications)
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, WB
SPR Antibody
(OTI4F5)
NBP2-03256
Flow Cytometry SPR Antibody (OTI4F5)
Flow Cytometry SPR Antibody (OTI4F5)
Western Blot SPR Antibody (OTI4F5)
Species: Hu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Albumin Antibody
(188835) [Unconjugate ...
MAB1455
Simple Western Albumin Antibody (188835) [Unconjugated] - Serum
Immunocytochemistry Albumin Antibody (188835) [Unconjugated] - Serum
Immunohistochemistry Albumin Antibody (188835) [Unconjugated] - Serum
(3 Reviews)
(54 Publications)
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ICC, IHC, ICFlow, Simple Western, WB
Myoglobin Antibody
[Unconjugated]
G-125-C
Myoglobin Antibody [Unconjugated]
Species: Hu
Kallikrein 3/PSA
[HRP]
DKK300
N/A Kallikrein 3/PSA [HRP]
N/A Kallikrein 3/PSA [HRP]
N/A Kallikrein 3/PSA [HRP]
(17 Publications)
Species: Hu
Applications: ELISA
Phenylalanine
Hydroxylase Antibody
NBP2-48615
Immunohistochemistry-Paraffin Phenylalanine Hydroxylase Antibody
Immunohistochemistry-Paraffin Phenylalanine Hydroxylase Antibody
Immunohistochemistry-Paraffin Phenylalanine Hydroxylase Antibody
(1 Publication)
Species: Hu
Applications: IHC, IHC-P, WB
Cytochrome c
Antibody (7H8.2C12) - ...
NB100-56503
Flow Cytometry Cytochrome c Antibody (7H8.2C12) - BSA Free
Flow (Intracellular) Cytochrome c Antibody (7H8.2C12) - BSA Free
Western Blot Cytochrome c Antibody (7H8.2C12) - BSA Free
(61 Publications)
Species: Dr, Hu, Mu, Rb, Rt
Applications: Flow-CS, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-P, Simple Western, WB
FLVCR Antibody
NB100-1481
Western Blot FLVCR Antibody
(1 Review)
(2 Publications)
Species: Hu
Applications: PEP-ELISA, WB
Lysozyme Antibody
- BSA Free
NBP2-61118
Simple Western Lysozyme Antibody - BSA Free
Flow Cytometry Lysozyme Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence Lysozyme Antibody - BSA Free
(7 Publications)
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, Simple Western, WB
SAR1 Antibody
NBP1-80789
Immunohistochemistry-Paraffin SAR1 Antibody
Western Blot SAR1 Antibody
(2 Publications)
Species: Hu
Applications: IHC, IHC-P, KD, WB
ZFYVE9 Antibody
(SR1275)
NBP3-22552
Western Blot ZFYVE9 Antibody (SR1275)
Species: Hu
Applications: IHC, WB
IL-17RD/SEF
Antibody
AF2275
Immunohistochemistry IL-17RD/SEF Antibody
Flow Cytometry IL-17RD/SEF Antibody
(1 Review)
(2 Publications)
Species: Hu
Applications: CyTOF-ready, Flow, IHC, WB
TFCP2 Antibody
H00007024-B01P
Western Blot TFCP2 Antibody
Western Blot TFCP2 Antibody
Western Blot TFCP2 Antibody
Species: Hu, Mu, Rt
Applications: WB
Granzyme A
Antibody [Unconjugate
AF2905
Immunocytochemistry Granzyme A Antibody [Unconjugated]
ELISA Granzyme A Antibody [Unconjugated]
Western Blot Granzyme A Antibody [Unconjugated]
Species: Hu
Applications: ELISA, ICC, WB
SARS2 Recombinant
Protein Antigen
NBP2-33666PEP
SARS2 Recombinant Protein Antigen
Species: Hu
Applications: AC

Publications for SARS2 Protein (NBP2-33666PEP) (0)

There are no publications for SARS2 Protein (NBP2-33666PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SARS2 Protein (NBP2-33666PEP) (0)

There are no reviews for SARS2 Protein (NBP2-33666PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for SARS2 Protein (NBP2-33666PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional SARS2 Products

Research Areas for SARS2 Protein (NBP2-33666PEP)

Find related products by research area.

Blogs on SARS2

There are no specific blogs for SARS2, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our SARS2 Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol SARS2