![Western Blot: RRN3 Antibody [H00054700-B01P] - Analysis of RRN3 expression in transfected 293T cell line by RRN3 polyclonal antibody. Lane 1: RRN3 transfected lysate(11.66 KDa). Lane 2: Non-transfected lysate.](http://images.novusbio.com/fullsize/RRN3-Antibody-Western-Blot-H00054700-B01P-img0004.jpg "Western Blot: RRN3 Antibody [H00054700-B01P] - Analysis of RRN3 expression in transfected 293T cell line by RRN3 polyclonal antibody. Lane 1: RRN3 transfected lysate(11.66 KDa). Lane 2: Non-transfected lysate.")
| Reactivity | HuSpecies Glossary |
| Applications | WB, ICC/IF |
| Clonality | Polyclonal |
| Host | Mouse |
| Conjugate | Unconjugated |
| Format | Azide and BSA Free |
| Immunogen | RRN3 (ENSP00000219758, 1 a.a. - 106 a.a.) full-length human protein. MRALENDFFNSPPRKTVRFGGTVTEVLLKYKKGETNDFELLKNQLLDPDIKDDQIINWLLEFRSSVMYLTKDFEQLISIILRLPWLNRSQTVVEEYLAFLGNLVSA |
| Specificity | RRN3 - RRN3 RNA polymerase I transcription factor homolog (S. cerevisiae), |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Mouse |
| Gene | RRN3 |
| Purity | Protein A purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Application Notes | Antibody reactive against Recombinant Protein with GST tag on ELISA and Western Blot and also on transfected lysate in western blot. GST tag alone is used as a negative control. It has also been used for immunofluorescence. |
| Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.4) |
| Preservative | No Preservative |
| Purity | Protein A purified |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | RRN3 |
| Entrez |
|
| Uniprot |
|
![Immunocytochemistry/Immunofluorescence: RRN3 Antibody [H00054700-B01P] - Analysis of purified antibody to RRN3 on HeLa cell. (antibody concentration 10 ug/ml)](http://images.novusbio.com/fullsize/RRN3-Antibody-Immunocytochemistry-Immunofluorescence-H00054700-B01P-img0003.jpg "Immunocytochemistry/Immunofluorescence: RRN3 Antibody [H00054700-B01P] - Analysis of purified antibody to RRN3 on HeLa cell. (antibody concentration 10 ug/ml)")
![Immunohistochemistry-Paraffin TOR/mTOR [p Ser2448] Antibody - BSA Free](https://images.novusbio.com/images/TOR-mTOR-[p-Ser2448]-Antibody-Immunohistochemistry-Paraffin-NB600-607-img0005.jpg)
![Western Blot TOR/mTOR [p Ser2448] Antibody - BSA Free](https://images.novusbio.com/images/TOR-mTOR-[p-Ser2448]-Antibody-Western-Blot-NB600-607-img0006.jpg)
![Data TOR/mTOR [p Ser2448] Antibody - BSA Free](https://images.novusbio.com/images/TOR-mTOR-[p-Ser2448]-Antibody-N-A-NB600-607-img0008.jpg)
![Immunocytochemistry RSK1 [p Ser380] Antibody (1024A) [Unconjugated]](https://images.novusbio.com/images2/RSK1_MAB79671_Immunocytochemistry_15894.jpg)
![Simple Western RSK1 [p Ser380] Antibody (1024A) [Unconjugated]](https://images.novusbio.com/images2/16242.jpg)
![Western Blot RSK1 [p Ser380] Antibody (1024A) [Unconjugated]](https://images.novusbio.com/images2/RSK1_MAB79671_Western_Blot_14193.jpg)
![Western Blot JNK2 Antibody (252320) [Unconjugated]](https://images.novusbio.com/images2/JNK2_MAB1846_Western_Blot_5997.jpg)
![Knockout Validated JNK2 Antibody (252320) [Unconjugated]](https://images.novusbio.com/images2/JNK2_MAB1846_Knockout_Validated_21983.jpg)
![Immunocytochemistry JNK2 Antibody (252320) [Unconjugated]](https://images.novusbio.com/images2/JNK2_MAB1846_Immunocytochemistry__Immunofluorescence_18732.jpg)
![Western Blot IGFBP-rp1/IGFBP-7 Antibody [Unconjugated]](https://images.novusbio.com/images2/IGFBPrp1_AF1334_Western_Blot_16698.jpg)
![Immunohistochemistry IGFBP-rp1/IGFBP-7 Antibody [Unconjugated]](https://images.novusbio.com/images2/IGFBPrp1_AF1334_Immunohistochemistry_17204.jpg)
![Flow Cytometry: Mouse IgG Isotype Control [NBP1-97019]](https://images.novusbio.com/images/Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP1-97019-img0004.jpg "Flow Cytometry: Mouse IgG Isotype Control [NBP1-97019]")