Home » RREB1 » RREB1 Antibodies » RREB1 Antibody
Novus Biologicals products are now on bio-techne.com

RREB1 Antibody

 Submit a Review

Images

 
(
Enlarge)
Immunocytochemistry/Immunofluorescence: RREB1 Antibody [NBP2-56824] - Staining of human cell line U-2 OS shows localization to nuclear speckles & nucleoli fibrillar center. Antibody staining is shown in green.
Immunocytochemistry/ Immunofluorescence: RREB1 Antibody [NBP2-56824] - Staining of human cell line U-2 OS shows localization to nuclear speckles & nucleoli fibrillar center. Antibody staining is shown in green.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

RREB1 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: GSVPKAATTATPAATTSPKESSEPPAPASSPEAASPTEQGPAGTSKKRGRKRGMRSRPRANSGGVDLDSSGEFASIEKMLATTDTNKFSPF
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RREB1
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
Application Notes
ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
RREB1 Recombinant Protein Antigen (NBP2-56824PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for RREB1 Antibody

  • DNA-binding protein
  • FINB
  • Finger protein in nuclear bodies
  • hindsight homolog
  • HNT
  • LZ321
  • Raf-responsive zinc finger protein LZ321
  • ras responsive element binding protein 1
  • ras-responsive element-binding protein 1
  • RREB-1
  • Zep-1
  • zinc finger motif enhancer binding protein 1
  • Zinc finger motif enhancer-binding protein 1
  • zinc finger motif-enhancer binding-protein 1

Background

RREB1 (also known as RAS-responsive element binding protein 1 and Raf responsive zinc finger protein) is a transcription factor that binds specifically to the distal RAS-responsive element (RRE) in the calcitonin gene promoter and augments the Ras/Raf-mediated transcriptional response of that promoter. RREB1 may be involved in Ras/Raf-mediated cell differentiation. RREB is a nuclear protein expressed in heart, placenta, lung, liver, skeletal muscle, kidney and pancreas and is not found in the brain. The protein contains 4 C2H2-type zinc fingers.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Cyclin D1 Antibody
(SPM587)
NBP2-32840
Western Blot Cyclin D1 Antibody (SPM587)
Flow Cytometry Cyclin D1 Antibody (SPM587)
Flow Cytometry Cyclin D1 Antibody (SPM587)
(1 Review)
(9 Publications)
Species: Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
c-Myb Antibody
NBP1-80306
Western Blot c-Myb Antibody
Immunohistochemistry-Paraffin c-Myb Antibody
Western Blot c-Myb Antibody
(1 Review)
(2 Publications)
Species: Av, Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
POMC Antibody
NB100-1533
Flow Cytometry POMC Antibody
Immunohistochemistry POMC Antibody
Immunohistochemistry POMC Antibody
(10 Publications)
Species: Hu, Mu, Po, Rt, Sh
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA, WB
c-jun [p Ser63]
Antibody (1018Y) [Unc ...
MAB8930
Western Blot c-jun [p Ser63] Antibody (1018Y) [Unconjugated]
Immunocytochemistry c-jun [p Ser63] Antibody (1018Y) [Unconjugated]
Simple Western c-jun [p Ser63] Antibody (1018Y) [Unconjugated]
(1 Review)
(3 Publications)
Species: Hu
Applications: ICC, Simple Western, WB
JNK1 Antibody
(228601) [Unconjugate
MAB17761
Western Blot JNK1 Antibody (228601) [Unconjugated]
Western Blot JNK1 Antibody (228601) [Unconjugated]
Immunocytochemistry JNK1 Antibody (228601) [Unconjugated]
(1 Review)
(3 Publications)
Species: Hu, Mu, Rt
Applications: ICC, WB
Kallikrein 3/PSA
[HRP]
DKK300
N/A Kallikrein 3/PSA [HRP]
N/A Kallikrein 3/PSA [HRP]
N/A Kallikrein 3/PSA [HRP]
(17 Publications)
Species: Hu
Applications: ELISA
Androgen R/NR3C4
[p Ser213, p Ser210] ...
NB100-56603
Western Blot Androgen R/NR3C4 [p Ser213, p Ser210] Antibody (156C135.2) - BSA Free
(14 Publications)
Species: Ca, Hu, Mu, Pm, Rt
Applications: IHC, IHC-P, WB
SLC39A3 Antibody
NBP1-86829
Western Blot SLC39A3 Antibody
Immunohistochemistry-Paraffin SLC39A3 Antibody
Immunocytochemistry/ Immunofluorescence SLC39A3 Antibody
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Procalcitonin
Antibody (44D9)
NB120-14817
Procalcitonin Antibody (44D9)
(1 Review)
(11 Publications)
Species: Hu, Rt
Applications: ICC/IF, IHC, S-ELISA, WB
p19ARF/CDKN2A
Antibody - BSA Free
NB200-106
Immunohistochemistry p19ARF/CDKN2A Antibody - BSA Free
Western Blot p19ARF/CDKN2A Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence p19ARF/CDKN2A Antibody - BSA Free
(1 Review)
(48 Publications)
Species: Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, WB
c-Fos Antibody
(2H2)
NBP2-50037
Knockout Validated c-Fos Antibody (2H2)
Immunocytochemistry/ Immunofluorescence c-Fos Antibody (2H2)
Immunocytochemistry/ Immunofluorescence c-Fos Antibody (2H2)
(1 Review)
(20 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, KO, WB
FosB/G0S3 Antibody
[Unconjugated]
AF2214
Immunocytochemistry FosB/G0S3 Antibody [Unconjugated]
Immunohistochemistry FosB/G0S3 Antibody [Unconjugated]
Species: Hu
Applications: ICC, IHC, WB
JunD Antibody
(512709)
MAB5526
Western Blot JunD Antibody (512709)
(2 Publications)
Species: Hu, Mu
Applications: WB
JunB/AP-1 Antibody
NBP1-89544
Immunocytochemistry/ Immunofluorescence JunB/AP-1 Antibody
Immunohistochemistry-Paraffin JunB/AP-1 Antibody
Immunohistochemistry-Paraffin JunB/AP-1 Antibody
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
p62/SQSTM1
Antibody (2C11)
H00008878-M01
Immunocytochemistry/ Immunofluorescence p62/SQSTM1 Antibody (2C11)
Western Blot p62/SQSTM1 Antibody (2C11)
Western Blot p62/SQSTM1 Antibody (2C11)
(9 Reviews)
(413 Publications)
Species: Bv, Ha, Hu, Mu, Rb, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
APE Antibody
(13B8E5C2) - BSA Free
NB100-116
Immunocytochemistry/ Immunofluorescence APE Antibody (13B8E5C2) - BSA Free
Western Blot APE Antibody (13B8E5C2) - BSA Free
Chromatin Immunoprecipitation (ChIP) APE Antibody (13B8E5C2) - BSA Free
(3 Reviews)
(107 Publications)
Species: Hu, Mu, Pm, Rt
Applications: ChIP, ELISA, GS, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD, PLA, Simple Western, WB
RalA/RalB Antibody
AF3204
Western Blot RalA/RalB Antibody
(1 Publication)
Species: Hu, Mu, Rt
Applications: WB
p53 Antibody (PAb
240) - BSA Free
NB200-103
Flow Cytometry p53 Antibody (PAb 240) - BSA Free
Flow Cytometry p53 Antibody (PAb 240) - BSA Free
Flow (Intracellular) p53 Antibody (PAb 240) - BSA Free
(3 Reviews)
(42 Publications)
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
AKAP5 Antibody -
BSA Free
NBP2-92794
Immunohistochemistry-Paraffin AKAP5 Antibody - BSA Free
Western Blot AKAP5 Antibody - BSA Free
Immunohistochemistry-Paraffin AKAP5 Antibody - BSA Free
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
RREB1 Antibody
NBP2-56824
RREB1 Antibody
Species: Hu
Applications: ICC/IF

Publications for RREB1 Antibody (NBP2-56824) (0)

There are no publications for RREB1 Antibody (NBP2-56824).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RREB1 Antibody (NBP2-56824) (0)

There are no reviews for RREB1 Antibody (NBP2-56824). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for RREB1 Antibody (NBP2-56824) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional RREB1 Products

Array NBP2-56824

Research Areas for RREB1 Antibody (NBP2-56824)

Find related products by research area.

Blogs on RREB1

There are no specific blogs for RREB1, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RREB1 Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol RREB1