![Western Blot: RPP40 Antibody [NBP1-88765] - Analysis in control (vector only transfected HEK293T lysate) and RPP40 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).](http://images.novusbio.com/fullsize/RPP40-Antibody-Western-Blot-NBP1-88765-img0007.jpg "Western Blot: RPP40 Antibody [NBP1-88765] - Analysis in control (vector only transfected HEK293T lysate) and RPP40 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).")
| Reactivity | HuSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: RALELFDWLGAVFSNVDLNNEPNNFISTYCCPEPSTVVAKAYLCTITGFILPEKICLLLEHLCHYFDEPKLAPWVTLSVQ |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | RPP40 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Immunohistochemistry BVES Antibody [Unconjugated]](https://images.novusbio.com/images/antibody/af4986_human-bves-affinity-purified-polyclonal-ab-immunohistochemistry-257202315566..jpg)
Secondary Antibodies |
Isotype Controls |
Research Areas for RPP40 Antibody (NBP1-88765)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | RPP40 |
![Immunocytochemistry/Immunofluorescence: RPP40 Antibody [NBP1-88765] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm.](http://images.novusbio.com/fullsize/RPP40-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-88765-img0006.jpg "Immunocytochemistry/Immunofluorescence: RPP40 Antibody [NBP1-88765] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm.")
![Immunohistochemistry-Paraffin: RPP40 Antibody [NBP1-88765] - Staining of human cerebral cortex shows cytoplasmic positivity in neuronal cells.](http://images.novusbio.com/fullsize/RPP40-Antibody-Immunohistochemistry-Paraffin-NBP1-88765-img0005.jpg "Immunohistochemistry-Paraffin: RPP40 Antibody [NBP1-88765] - Staining of human cerebral cortex shows cytoplasmic positivity in neuronal cells.")
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")