Novus Biologicals products are now on bio-techne.com

RPL30 Recombinant Protein Antigen

Name: RPL30 Recombinant Protein Antigen
Brand: Novus Biologicals
SKU: NBP1-82855PEP
Price: 279 USD

Images

There are currently no images for RPL30 Protein (NBP1-82855PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary

Reactivity	HuSpecies Glossary
Applications	AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

RPL30 Recombinant Protein Antigen Summary

Description	A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human RPL30. Source: E. coli Amino Acid Sequence: INSRLQLVMKSGKYVLGYKQTLKMIRQGKAKLVILANNCPALRKSEIEYYAMLAKTGVHHYSGNNIELGTACGKYYRVCTLAIIDPGDSDIIRSMPEQTGEK Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G) This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source	E. coli
Protein/Peptide Type	Recombinant Protein Antigen
Gene	RPL30
Purity	>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions	Antibody Competition 10 - 100 molar excess
Application Notes	This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-82855. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml. For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com
Theoretical MW	29 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage	Store at -20C. Avoid freeze-thaw cycles.
Buffer	PBS and 1M Urea, pH 7.4.
Preservative	No Preservative
Purity	>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for RPL30 Recombinant Protein Antigen

60S ribosomal protein L30
ribosomal protein L30

Background

Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. This gene encodes a ribosomal protein that is a component of the 60S subunit. The protein belongs to the L30E family of ribosomal proteins. It is located in the cytoplasm. This gene is co-transcribed with the U72 small nucleolar RNA gene, which is located in its fourth intron. As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed through the genome. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

RPL29 Antibody

NBP3-12600

Immunohistochemistry-Paraffin RPL29 Antibody

Species: Hu

Applications: ICC/IF, IHC-P, IP, WB

RPL32 Antibody
(HL2329) - Azide and ...

NBP3-25485

Western Blot RPL32 Antibody (HL2329) - Azide and BSA Free

Immunocytochemistry/ Immunofluorescence RPL32 Antibody (HL2329) - Azide and BSA Free

Species: Ca, Hu, Mu, Rt, Ze

Applications: ICC/IF, IHC, IHC-P, WB

Ribosomal Protein
L24 Antibody - Azide ...

NBP2-93788

Immunohistochemistry-Paraffin Ribosomal Protein L24 Antibody - Azide and BSA Free

Western Blot Ribosomal Protein L24 Antibody - Azide and BSA Free

Species: Hu, Mu, Rt

Applications: ICC/IF, IHC, IHC-P, WB

RPL18 Antibody

NBP2-13251

Immunocytochemistry/ Immunofluorescence RPL18 Antibody

Species: Hu

Applications: ICC/IF, IHC, IHC-P, WB

RPL6 Antibody

NBP2-20216

Species: Hu, Mu, Rt

Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB

TEX10 Antibody

NBP3-09260

Species: Hu

Applications: WB

RPL5 Antibody

NBP1-31413

Immunohistochemistry-Paraffin RPL5 Antibody

(1 Publication)

Species: Hu, Mu, Rt

Applications: ICC/IF, IHC, IHC-P, KD, WB

RPL11 Antibody

NBP2-20210

(1 Review)

Species: Hu, I, Mu, Ze

Applications: IHC-WhMt, IHC, IHC-P, WB

RPL15 Antibody

NBP2-20212

Species: Hu

Applications: IHC, IHC-P, WB

RPL9 Antibody

NBP1-82853

(2 Publications)

Species: Hu, Mu

Applications: ICC/IF, IHC, IHC-P, WB

MED10 Antibody

NBP1-81328

Immunocytochemistry/ Immunofluorescence MED10 Antibody

Species: Hu

Applications: ICC/IF, WB

TM4SF1/L6 Antibody
(877621) [Unconjugate ...

MAB8164

Flow Cytometry TM4SF1/L6 Antibody (877621) [Unconjugated]

(2 Publications)

Species: Hu

Applications: CyTOF-ready, Flow, ICC, IHC

RPL14 Antibody

NBP1-85385

Immunohistochemistry-Paraffin RPL14 Antibody

Immunocytochemistry/ Immunofluorescence RPL14 Antibody

Species: Hu

Applications: ICC/IF, IHC, IHC-P, WB

HN1L Antibody

NBP1-88446

Immunohistochemistry-Paraffin HN1L Antibody

Species: Hu

Applications: ICC/IF, IHC, IHC-P, WB

RPL7 Antibody

NB100-2269

(1 Review)

(9 Publications)

Species: Hu, Mu

Applications: IHC, IHC-P, IP, KD, WB

RPS20 Antibody

NBP1-80804

(7 Publications)

Species: Hu

Applications: ICC/IF, IHC, IHC-P, WB

RPL19 Antibody
(3H4)

H00006143-M01

(1 Review)

(9 Publications)

Species: Hu, Mu, Rt, Ye

Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, WB

PDLIM5 Antibody

NBP1-84843

Immunohistochemistry-Paraffin PDLIM5 Antibody

(1 Publication)

Species: Hu

Applications: ICC/IF, IHC, IHC-P, WB

RPL27 Antibody -
Azide and BSA Free

NBP2-94240

Species: Hu, Mu, Rt

Applications: ICC/IF, WB

RPL30 Recombinant
Protein Antigen

NBP1-82855PEP

Species: Hu

Applications: AC

Publications for RPL30 Protein (NBP1-82855PEP) (0)

There are no publications for RPL30 Protein (NBP1-82855PEP).

By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RPL30 Protein (NBP1-82855PEP) (0)

There are no reviews for RPL30 Protein (NBP1-82855PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.

Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for RPL30 Protein (NBP1-82855PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional RPL30 Products

Research Areas for RPL30 Protein (NBP1-82855PEP)

Find related products by research area.

DNA replication, Transcription, Translation and Splicing

Blogs on RPL30.

Check out the latest blog posts on RPL30.

New Primers Available for ChIP Procedures
Novus has recently released six new primer sets designed for use in real-time PCR DNA amplification of housekeeping, silent, or heterochromatin associated proteins. Specifically, the primers are for GAPDH, RPL30, MyoD1, AFM, alpha Satellite, and Satel... Read full blog post.

Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

RPL19 Antibody (3H4)
H00006143-M01

RPL7 Antibody
NB100-2269

Contact Information

Product PDFs

SDS

PDF Datasheet

Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

Volume

Mass

Concentration

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

Mass

Concentration

Volume

Molecular Weight* g/mol

Review this Product

Be the first to review our RPL30 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol

RPL30

Popular Products	Company Information	Support	Stay Connected
Antibodies Secondary Antibodies Isotype Controls Proteins and Peptides ELISA Kits Sample Size New Products	About Us Careers Novus Guarantee Contact Us Our Team	Technical Support FAQs Help Finding Antibodies Protocols

Visit our other sites

At	=	A. thaliana	SyHa	=	Golden Syrian Hamster
All	=	All Species	Ha	=	Hamster
An	=	Animal	Hu	=	Human
ArHa	=	Armenian Hamster	I	=	Insect
Av	=	Avian	Ll	=	Llama
Bb	=	Baboon	Ma	=	Mammal
Ba	=	Bacteria	Mk	=	Monkey
Bv	=	Bovine	Mu	=	Mouse
Ca	=	Canine	Multi	=	Multi-species
Ce	=	C. Elegans	NA	=	Non-species specific
Ch	=	Chicken	Or	=	Orangutan
ChHa	=	Chinese Hamster	Pl	=	Plant
Cm	=	Cynomolgus Monkey	Pm	=	Primate
Do	=	Donkey	Po	=	Porcine
Dr	=	Drosophilia	Rb	=	Rabbit
Ec	=	E. Coli	Rt	=	Rat
Eq	=	Equine	RM	=	Rhesus Macaque
Fe	=	Feline	Sh	=	Sheep
Ft	=	Ferret	Vb	=	Vertebrate
Fi	=	Fish	Vi	=	Virus
Fu	=	Fungi	Xp	=	Xenopus
Ge	=	Gerbil	Ye	=	Yeast
GP	=	Guinea Pig	Ze	=	Zebrafish
Gt	=	Goat

RPL30 Recombinant Protein Antigen

Species Glossary

Images

Product Details

Order Details

RPL30 Recombinant Protein Antigen Summary

Applications/Dilutions

Packaging, Storage & Formulations

Alternate Names for RPL30 Recombinant Protein Antigen

Background

Limitations

Customers Who Viewed This Item Also Viewed...

Publications for RPL30 Protein (NBP1-82855PEP) (0)

Reviews for RPL30 Protein (NBP1-82855PEP) (0)

FAQs for RPL30 Protein (NBP1-82855PEP) (0)

Additional RPL30 Products

Research Areas for RPL30 Protein (NBP1-82855PEP)

Blogs on RPL30.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Molarity Calculator

Review this Product

Bioinformatics